NameDNA dC->dU-editing enzyme APOBEC-3G
Synonyms
  • 3.5.4.-
  • A3G
  • APOBEC-related cytidine deaminase
  • APOBEC-related protein
  • APOBEC-related protein 9
  • ARCD
  • ARP-9
  • CEM-15
  • CEM15
  • Deoxycytidine deaminase
Gene NameAPOBEC3G
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009823|DNA dC->dU-editing enzyme APOBEC-3G
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYS
ELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFV
ARLYYFWDPDYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPK
YYILLHIMLGEILRHSMDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRG
FLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFIS
KNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQP
WDGLDEHSQDLSGRLRAILQNQEN
Number of residues384
Molecular Weight46407.605
Theoretical pINot Available
GO Classification
Functions
  • RNA binding
  • cytidine deaminase activity
  • protein homodimerization activity
  • deoxycytidine deaminase activity
  • zinc ion binding
Processes
  • base conversion or substitution editing
  • DNA cytosine deamination
  • negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
  • negative regulation of transposition
  • innate immune response
  • positive regulation of defense response to virus by host
  • viral process
  • defense response to virus
  • negative regulation of viral genome replication
  • cytidine deamination
  • negative regulation of viral process
Components
  • cytoplasm
  • ribonucleoprotein complex
  • cytosol
  • cytoplasmic mRNA processing body
  • apolipoprotein B mRNA editing enzyme complex
General FunctionZinc ion binding
Specific FunctionDNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. Exhibits potent antiviral activity against vif-deficient HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA. The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single-or double-stranded RNA. Exhibits antiviral activity also against simian immunodeficiency viruses (SIVs), hepatitis B virus (HBV), equine infectious anemia virus (EIAV), xenotropic MuLV-related virus (XMRV) and simian foamy virus (SFV). May inhibit the mobility of LTR and non-LTR retrotransposons.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9HC16
UniProtKB Entry NameABC3G_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0020909|DNA dC->dU-editing enzyme APOBEC-3G (APOBEC3G)
ATGAAGCCTCACTTCAGAAACACAGTGGAGCGAATGTATCGAGACACATTCTCCTACAAC
TTTTATAATAGACCCATCCTTTCTCGTCGGAATACCGTCTGGCTGTGCTACGAAGTGAAA
ACAAAGGGTCCCTCAAGGCCCCCTTTGGACGCAAAGATCTTTCGAGGCCAGGTGTATTCC
GAACTTAAGTACCACCCAGAGATGAGATTCTTCCACTGGTTCAGCAAGTGGAGGAAGCTG
CATCGTGACCAGGAGTATGAGGTCACCTGGTACATATCCTGGAGCCCCTGCACAAAGTGT
ACAAGGGATATGGCCACGTTCCTGGCCGAGGACCCGAAGGTTACCCTGACCATCTTTGTT
GCCCGCCTCTACTACTTCTGGGACCCAGATTACCAGGAGGCGCTTCGCAGCCTGTGTCAG
AAAAGAGACGGTCCGCGTGCCACCATGAAGATCATGAATTATGACGAATTTCAGCACTGT
TGGAGCAAGTTCGTGTACAGCCAAAGAGAGCTATTTGAGCCTTGGAATAATCTGCCTAAA
TATTATATATTACTGCACATCATGCTGGGGGAGATTCTCAGACACTCGATGGATCCACCC
ACATTCACTTTCAACTTTAACAATGAACCTTGGGTCAGAGGACGGCATGAGACTTACCTG
TGTTATGAGGTGGAGCGCATGCACAATGACACCTGGGTCCTGCTGAACCAGCGCAGGGGC
TTTCTATGCAACCAGGCTCCACATAAACACGGTTTCCTTGAAGGCCGCCATGCAGAGCTG
TGCTTCCTGGACGTGATTCCCTTTTGGAAGCTGGACCTGGACCAGGACTACAGGGTTACC
TGCTTCACCTCCTGGAGCCCCTGCTTCAGCTGTGCCCAGGAAATGGCTAAATTCATTTCA
AAAAACAAACACGTGAGCCTGTGCATCTTCACTGCCCGCATCTATGATGATCAAGGAAGA
TGTCAGGAGGGGCTGCGCACCCTGGCCGAGGCTGGGGCCAAAATTTCAATAATGACATAC
AGTGAATTTAAGCACTGCTGGGACACCTTTGTGGACCACCAGGGATGTCCCTTCCAGCCC
TGGGATGGACTAGATGAGCACAGCCAAGACCTGAGTGGGAGGCTGCGGGCCATTCTCCAG
AATCAGGAAAACTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:17357
Chromosome Location22
LocusNot Available
References
  1. Kao S, Khan MA, Miyagi E, Plishka R, Buckler-White A, Strebel K: The human immunodeficiency virus type 1 Vif protein reduces intracellular expression and inhibits packaging of APOBEC3G (CEM15), a cellular inhibitor of virus infectivity. J Virol. 2003 Nov;77(21):11398-407. 14557625
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. 15461802
  4. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. 10591208
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Jarmuz A, Chester A, Bayliss J, Gisbourne J, Dunham I, Scott J, Navaratnam N: An anthropoid-specific locus of orphan C to U RNA-editing enzymes on chromosome 22. Genomics. 2002 Mar;79(3):285-96. 11863358
  7. Sheehy AM, Gaddis NC, Choi JD, Malim MH: Isolation of a human gene that inhibits HIV-1 infection and is suppressed by the viral Vif protein. Nature. 2002 Aug 8;418(6898):646-50. Epub 2002 Jul 14. 12167863
  8. Mangeat B, Turelli P, Caron G, Friedli M, Perrin L, Trono D: Broad antiretroviral defence by human APOBEC3G through lethal editing of nascent reverse transcripts. Nature. 2003 Jul 3;424(6944):99-103. Epub 2003 May 28. 12808466
  9. Harris RS, Bishop KN, Sheehy AM, Craig HM, Petersen-Mahrt SK, Watt IN, Neuberger MS, Malim MH: DNA deamination mediates innate immunity to retroviral infection. Cell. 2003 Jun 13;113(6):803-9. 12809610
  10. Zhang H, Yang B, Pomerantz RJ, Zhang C, Arunachalam SC, Gao L: The cytidine deaminase CEM15 induces hypermutation in newly synthesized HIV-1 DNA. Nature. 2003 Jul 3;424(6944):94-8. Epub 2003 May 28. 12808465
  11. Mariani R, Chen D, Schrofelbauer B, Navarro F, Konig R, Bollman B, Munk C, Nymark-McMahon H, Landau NR: Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif. Cell. 2003 Jul 11;114(1):21-31. 12859895
  12. Shindo K, Takaori-Kondo A, Kobayashi M, Abudu A, Fukunaga K, Uchiyama T: The enzymatic activity of CEM15/Apobec-3G is essential for the regulation of the infectivity of HIV-1 virion but not a sole determinant of its antiviral activity. J Biol Chem. 2003 Nov 7;278(45):44412-6. Epub 2003 Sep 11. 12970355
  13. Stopak K, de Noronha C, Yonemoto W, Greene WC: HIV-1 Vif blocks the antiviral activity of APOBEC3G by impairing both its translation and intracellular stability. Mol Cell. 2003 Sep;12(3):591-601. 14527406
  14. Marin M, Rose KM, Kozak SL, Kabat D: HIV-1 Vif protein binds the editing enzyme APOBEC3G and induces its degradation. Nat Med. 2003 Nov;9(11):1398-403. Epub 2003 Oct 5. 14528301
  15. Sheehy AM, Gaddis NC, Malim MH: The antiretroviral enzyme APOBEC3G is degraded by the proteasome in response to HIV-1 Vif. Nat Med. 2003 Nov;9(11):1404-7. Epub 2003 Oct 5. 14528300
  16. Wedekind JE, Dance GS, Sowden MP, Smith HC: Messenger RNA editing in mammals: new members of the APOBEC family seeking roles in the family business. Trends Genet. 2003 Apr;19(4):207-16. 12683974
  17. Vartanian JP, Sommer P, Wain-Hobson S: Death and the retrovirus. Trends Mol Med. 2003 Oct;9(10):409-13. 14557052
  18. Cullen BR: HIV-1 Vif: counteracting innate antiretroviral defenses. Mol Ther. 2003 Oct;8(4):525-7. 14565218
  19. Xu H, Svarovskaia ES, Barr R, Zhang Y, Khan MA, Strebel K, Pathak VK: A single amino acid substitution in human APOBEC3G antiretroviral enzyme confers resistance to HIV-1 virion infectivity factor-induced depletion. Proc Natl Acad Sci U S A. 2004 Apr 13;101(15):5652-7. Epub 2004 Mar 30. 15054139
  20. Turelli P, Mangeat B, Jost S, Vianin S, Trono D: Inhibition of hepatitis B virus replication by APOBEC3G. Science. 2004 Mar 19;303(5665):1829. 15031497
  21. Chen H, Lilley CE, Yu Q, Lee DV, Chou J, Narvaiza I, Landau NR, Weitzman MD: APOBEC3A is a potent inhibitor of adeno-associated virus and retrotransposons. Curr Biol. 2006 Mar 7;16(5):480-5. 16527742
  22. Hakata Y, Landau NR: Reversed functional organization of mouse and human APOBEC3 cytidine deaminase domains. J Biol Chem. 2006 Dec 1;281(48):36624-31. Epub 2006 Oct 4. 17020885
  23. Delebecque F, Suspene R, Calattini S, Casartelli N, Saib A, Froment A, Wain-Hobson S, Gessain A, Vartanian JP, Schwartz O: Restriction of foamy viruses by APOBEC cytidine deaminases. J Virol. 2006 Jan;80(2):605-14. 16378963
  24. Wichroski MJ, Robb GB, Rana TM: Human retroviral host restriction factors APOBEC3G and APOBEC3F localize to mRNA processing bodies. PLoS Pathog. 2006 May;2(5):e41. Epub 2006 May 12. 16699599
  25. Chiu YL, Greene WC: The APOBEC3 cytidine deaminases: an innate defensive network opposing exogenous retroviruses and endogenous retroelements. Annu Rev Immunol. 2008;26:317-53. doi: 10.1146/annurev.immunol.26.021607.090350. 18304004
  26. Bonvin M, Greeve J: Hepatitis B: modern concepts in pathogenesis--APOBEC3 cytidine deaminases as effectors in innate immunity against the hepatitis B virus. Curr Opin Infect Dis. 2008 Jun;21(3):298-303. doi: 10.1097/QCO.0b013e3282fe1bb2. 18448976
  27. Bennett RP, Salter JD, Liu X, Wedekind JE, Smith HC: APOBEC3G subunits self-associate via the C-terminal deaminase domain. J Biol Chem. 2008 Nov 28;283(48):33329-36. doi: 10.1074/jbc.M803726200. Epub 2008 Oct 8. 18842592
  28. Stenglein MD, Matsuo H, Harris RS: Two regions within the amino-terminal half of APOBEC3G cooperate to determine cytoplasmic localization. J Virol. 2008 Oct;82(19):9591-9. doi: 10.1128/JVI.02471-07. Epub 2008 Jul 30. 18667511
  29. Shirakawa K, Takaori-Kondo A, Yokoyama M, Izumi T, Matsui M, Io K, Sato T, Sato H, Uchiyama T: Phosphorylation of APOBEC3G by protein kinase A regulates its interaction with HIV-1 Vif. Nat Struct Mol Biol. 2008 Nov;15(11):1184-91. doi: 10.1038/nsmb.1497. Epub 2008 Oct 5. 18836454
  30. Zielonka J, Bravo IG, Marino D, Conrad E, Perkovic M, Battenberg M, Cichutek K, Munk C: Restriction of equine infectious anemia virus by equine APOBEC3 cytidine deaminases. J Virol. 2009 Aug;83(15):7547-59. doi: 10.1128/JVI.00015-09. Epub 2009 May 20. 19458006
  31. Chiu YL, Greene WC: APOBEC3G: an intracellular centurion. Philos Trans R Soc Lond B Biol Sci. 2009 Mar 12;364(1517):689-703. doi: 10.1098/rstb.2008.0193. 19008196
  32. Mbisa JL, Bu W, Pathak VK: APOBEC3F and APOBEC3G inhibit HIV-1 DNA integration by different mechanisms. J Virol. 2010 May;84(10):5250-9. doi: 10.1128/JVI.02358-09. Epub 2010 Mar 10. 20219927
  33. Paprotka T, Venkatachari NJ, Chaipan C, Burdick R, Delviks-Frankenberry KA, Hu WS, Pathak VK: Inhibition of xenotropic murine leukemia virus-related virus by APOBEC3 proteins and antiviral drugs. J Virol. 2010 Jun;84(11):5719-29. doi: 10.1128/JVI.00134-10. Epub 2010 Mar 24. 20335265
  34. Refsland EW, Stenglein MD, Shindo K, Albin JS, Brown WL, Harris RS: Quantitative profiling of the full APOBEC3 mRNA repertoire in lymphocytes and tissues: implications for HIV-1 restriction. Nucleic Acids Res. 2010 Jul;38(13):4274-84. doi: 10.1093/nar/gkq174. Epub 2010 Mar 22. 20308164
  35. Zhao D, Wang X, Lou G, Peng G, Li J, Zhu H, Chen F, Li S, Liu D, Chen Z, Yang Z: APOBEC3G directly binds Hepatitis B virus core protein in cell and cell free systems. Virus Res. 2010 Aug;151(2):213-9. doi: 10.1016/j.virusres.2010.05.009. Epub 2010 May 25. 20510315
  36. Demorest ZL, Li M, Harris RS: Phosphorylation directly regulates the intrinsic DNA cytidine deaminase activity of activation-induced deaminase and APOBEC3G protein. J Biol Chem. 2011 Jul 29;286(30):26568-75. doi: 10.1074/jbc.M111.235721. Epub 2011 Jun 9. 21659520
  37. Bulliard Y, Narvaiza I, Bertero A, Peddi S, Rohrig UF, Ortiz M, Zoete V, Castro-Diaz N, Turelli P, Telenti A, Michielin O, Weitzman MD, Trono D: Structure-function analyses point to a polynucleotide-accommodating groove essential for APOBEC3A restriction activities. J Virol. 2011 Feb;85(4):1765-76. doi: 10.1128/JVI.01651-10. Epub 2010 Dec 1. 21123384
  38. Hultquist JF, Lengyel JA, Refsland EW, LaRue RS, Lackey L, Brown WL, Harris RS: Human and rhesus APOBEC3D, APOBEC3F, APOBEC3G, and APOBEC3H demonstrate a conserved capacity to restrict Vif-deficient HIV-1. J Virol. 2011 Nov;85(21):11220-34. doi: 10.1128/JVI.05238-11. Epub 2011 Aug 10. 21835787
  39. Smith HC: APOBEC3G: a double agent in defense. Trends Biochem Sci. 2011 May;36(5):239-44. doi: 10.1016/j.tibs.2010.12.003. Epub 2011 Jan 14. 21239176
  40. Li X, Ma J, Zhang Q, Zhou J, Yin X, Zhai C, You X, Yu L, Guo F, Zhao L, Li Z, Zeng Y, Cen S: Functional analysis of the two cytidine deaminase domains in APOBEC3G. Virology. 2011 Jun 5;414(2):130-6. doi: 10.1016/j.virol.2011.03.014. Epub 2011 Apr 13. 21489586
  41. Imahashi M, Nakashima M, Iwatani Y: Antiviral Mechanism and Biochemical Basis of the Human APOBEC3 Family. Front Microbiol. 2012 Jul 9;3:250. doi: 10.3389/fmicb.2012.00250. eCollection 2012. 22787460
  42. Arias JF, Koyama T, Kinomoto M, Tokunaga K: Retroelements versus APOBEC3 family members: No great escape from the magnificent seven. Front Microbiol. 2012 Aug 14;3:275. doi: 10.3389/fmicb.2012.00275. eCollection 2012. 22912627
  43. Liu C, Zhang X, Huang F, Yang B, Li J, Liu B, Luo H, Zhang P, Zhang H: APOBEC3G inhibits microRNA-mediated repression of translation by interfering with the interaction between Argonaute-2 and MOV10. J Biol Chem. 2012 Aug 24;287(35):29373-83. doi: 10.1074/jbc.M112.354001. Epub 2012 Jul 12. 22791714
  44. Wang X, Ao Z, Chen L, Kobinger G, Peng J, Yao X: The cellular antiviral protein APOBEC3G interacts with HIV-1 reverse transcriptase and inhibits its function during viral replication. J Virol. 2012 Apr;86(7):3777-86. doi: 10.1128/JVI.06594-11. Epub 2012 Feb 1. 22301159
  45. Phalora PK, Sherer NM, Wolinsky SM, Swanson CM, Malim MH: HIV-1 replication and APOBEC3 antiviral activity are not regulated by P bodies. J Virol. 2012 Nov;86(21):11712-24. doi: 10.1128/JVI.00595-12. Epub 2012 Aug 22. 22915799
  46. Refsland EW, Hultquist JF, Harris RS: Endogenous origins of HIV-1 G-to-A hypermutation and restriction in the nonpermissive T cell line CEM2n. PLoS Pathog. 2012;8(7):e1002800. doi: 10.1371/journal.ppat.1002800. Epub 2012 Jul 12. 22807680
  47. Monajemi M, Woodworth CF, Benkaroun J, Grant M, Larijani M: Emerging complexities of APOBEC3G action on immunity and viral fitness during HIV infection and treatment. Retrovirology. 2012 Apr 30;9:35. doi: 10.1186/1742-4690-9-35. 22546055
  48. Smith HC, Bennett RP, Kizilyer A, McDougall WM, Prohaska KM: Functions and regulation of the APOBEC family of proteins. Semin Cell Dev Biol. 2012 May;23(3):258-68. doi: 10.1016/j.semcdb.2011.10.004. Epub 2011 Oct 6. 22001110
  49. Chaipan C, Smith JL, Hu WS, Pathak VK: APOBEC3G restricts HIV-1 to a greater extent than APOBEC3F and APOBEC3DE in human primary CD4+ T cells and macrophages. J Virol. 2013 Jan;87(1):444-53. doi: 10.1128/JVI.00676-12. Epub 2012 Oct 24. 23097438
  50. Gillick K, Pollpeter D, Phalora P, Kim EY, Wolinsky SM, Malim MH: Suppression of HIV-1 infection by APOBEC3 proteins in primary human CD4(+) T cells is associated with inhibition of processive reverse transcription as well as excessive cytidine deamination. J Virol. 2013 Feb;87(3):1508-17. doi: 10.1128/JVI.02587-12. Epub 2012 Nov 14. 23152537
  51. Chen KM, Harjes E, Gross PJ, Fahmy A, Lu Y, Shindo K, Harris RS, Matsuo H: Structure of the DNA deaminase domain of the HIV-1 restriction factor APOBEC3G. Nature. 2008 Mar 6;452(7183):116-9. doi: 10.1038/nature06638. Epub 2008 Feb 20. 18288108
  52. Holden LG, Prochnow C, Chang YP, Bransteitter R, Chelico L, Sen U, Stevens RC, Goodman MF, Chen XS: Crystal structure of the anti-viral APOBEC3G catalytic domain and functional implications. Nature. 2008 Nov 6;456(7218):121-4. doi: 10.1038/nature07357. Epub 2008 Oct 12. 18849968
  53. Furukawa A, Nagata T, Matsugami A, Habu Y, Sugiyama R, Hayashi F, Kobayashi N, Yokoyama S, Takaku H, Katahira M: Structure, interaction and real-time monitoring of the enzymatic reaction of wild-type APOBEC3G. EMBO J. 2009 Feb 18;28(4):440-51. doi: 10.1038/emboj.2008.290. Epub 2009 Jan 15. 19153609
  54. Li M, Shandilya SM, Carpenter MA, Rathore A, Brown WL, Perkins AL, Harki DA, Solberg J, Hook DJ, Pandey KK, Parniak MA, Johnson JR, Krogan NJ, Somasundaran M, Ali A, Schiffer CA, Harris RS: First-in-class small molecule inhibitors of the single-strand DNA cytosine deaminase APOBEC3G. ACS Chem Biol. 2012 Mar 16;7(3):506-17. doi: 10.1021/cb200440y. Epub 2012 Jan 17. 22181350