NameDNA-directed RNA polymerase II subunit RPB11-b2
Synonyms
  • DNA-directed RNA polymerase II subunit J3
  • RNA polymerase II subunit B11-b2
Gene NamePOLR2J3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017670|DNA-directed RNA polymerase II subunit RPB11-b2
MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGY
KVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP
Number of residues115
Molecular Weight13092.11
Theoretical pINot Available
GO Classification
Functions
  • DNA binding
  • DNA-directed RNA polymerase activity
Processes
  • transcription from RNA polymerase II promoter
Components
  • DNA-directed RNA polymerase II, core complex
General FunctionDna-directed rna polymerase activity
Specific FunctionDNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft (By similarity).
Pfam Domain FunctionNot Available
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9H1A7
UniProtKB Entry NameRPB1C_HUMAN
Cellular LocationNucleus
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:33853
Chromosome LocationNot Available
LocusNot Available
References
  1. Grandemange S, Schaller S, Yamano S, Du Manoir S, Shpakovski GV, Mattei MG, Kedinger C, Vigneron M: A human RNA polymerase II subunit is encoded by a recently generated multigene family. BMC Mol Biol. 2001;2:14. Epub 2001 Nov 30. 11747469
  2. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. 12853948