NameSodium channel subunit beta-4
SynonymsNot Available
Gene NameSCN4B
OrganismHuman
Amino acid sequence
>lcl|BSEQ0006993|Sodium channel subunit beta-4
MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFG
FEDLHFRWTYNSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRD
LEFSDTGKYTCHVKNPKENNLQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILI
LLIKKLIIFILKKTREKKKECLVSSSGNDNTENGLPGSKAEEKPPSKV
Number of residues228
Molecular Weight24968.755
Theoretical pI7.45
GO Classification
Functions
  • sodium channel regulator activity
  • voltage-gated sodium channel activity
  • ion channel binding
  • voltage-gated sodium channel activity involved in cardiac muscle cell action potential
Processes
  • cardiac muscle cell action potential involved in contraction
  • cardiac muscle contraction
  • membrane depolarization during cardiac muscle cell action potential
  • positive regulation of sodium ion transport
  • regulation of heart rate by cardiac conduction
  • regulation of ventricular cardiac muscle cell membrane repolarization
  • sodium ion transport
  • regulation of sodium ion transmembrane transporter activity
  • sodium ion transmembrane transport
  • AV node cell action potential
Components
  • intrinsic component of plasma membrane
  • voltage-gated sodium channel complex
  • intercalated disc
General FunctionVoltage-gated sodium channel activity involved in cardiac muscle cell action potential
Specific FunctionModulates channel gating kinetics. Causes negative shifts in the voltage dependence of activation of certain alpha sodium channels, but does not affect the voltage dependence of inactivation. Modulates the suceptibility of the sodium channel to inhibition by toxic peptides from spider, scorpion, wasp and sea anemone venom.
Pfam Domain Function
Transmembrane Regions163-183
GenBank Protein ID27465047
UniProtKB IDQ8IWT1
UniProtKB Entry NameSCN4B_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0017169|Sodium channel subunit beta-4 (SCN4B)
ATGCCCGGGGCTGGGGACGGAGGCAAAGCCCCGGCGAGATGGCTGGGCACTGGGCTTTTG
GTGGAAGAAGTGGACAACACAGTGACACTCATCATCCTGGCTGTCGTGGGCGGGGTCATC
GGGCTCCTCATCCTCATCCTGCTGATCAAGAAACTCATCATCTTCATCCTGAAGAAGACT
CGGGAGAAGAAGAAGGAGTGTCTCGTGAGCTCCTCGGGGAATGACAACACGGAGAACGGC
TTGCCTGGCTCCAAGGCAGAGGAGAAACCACCTTCAAAAGTGTGA
GenBank Gene IDAY149967
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:10592
Chromosome Location11
Locus11q23.3
References
  1. Yu FH, Westenbroek RE, Silos-Santiago I, McCormick KA, Lawson D, Ge P, Ferriera H, Lilly J, DiStefano PS, Catterall WA, Scheuer T, Curtis R: Sodium channel beta4, a new disulfide-linked auxiliary subunit with similarity to beta2. J Neurosci. 2003 Aug 20;23(20):7577-85. 12930796
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. 16554811
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Gilchrist J, Das S, Van Petegem F, Bosmans F: Crystallographic insights into sodium-channel modulation by the beta4 subunit. Proc Natl Acad Sci U S A. 2013 Dec 17;110(51):E5016-24. doi: 10.1073/pnas.1314557110. Epub 2013 Dec 2. 24297919
  5. Medeiros-Domingo A, Kaku T, Tester DJ, Iturralde-Torres P, Itty A, Ye B, Valdivia C, Ueda K, Canizales-Quinteros S, Tusie-Luna MT, Makielski JC, Ackerman MJ: SCN4B-encoded sodium channel beta4 subunit in congenital long-QT syndrome. Circulation. 2007 Jul 10;116(2):134-42. Epub 2007 Jun 25. 17592081
  6. Olesen MS, Jespersen T, Nielsen JB, Liang B, Moller DV, Hedley P, Christiansen M, Varro A, Olesen SP, Haunso S, Schmitt N, Svendsen JH: Mutations in sodium channel beta-subunit SCN3B are associated with early-onset lone atrial fibrillation. Cardiovasc Res. 2011 Mar 1;89(4):786-93. doi: 10.1093/cvr/cvq348. Epub 2010 Nov 4. 21051419
  7. Li RG, Wang Q, Xu YJ, Zhang M, Qu XK, Liu X, Fang WY, Yang YQ: Mutations of the SCN4B-encoded sodium channel beta4 subunit in familial atrial fibrillation. Int J Mol Med. 2013 Jul;32(1):144-50. doi: 10.3892/ijmm.2013.1355. Epub 2013 Apr 22. 23604097