NamePutative histone H2B type 2-D
SynonymsNot Available
Gene NameHIST2H2BD
OrganismHuman
Amino acid sequence
>lcl|BSEQ0020841|Putative histone H2B type 2-D
MPEPAKFAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKRVHPDTGIWCKAM
GIMNSFLNDIFERIAGEASRLAHYNKRSTITSRRSRRPCACCCPASWPSTPCPRAPRRSP
STPAPSESLPGPGARSLPPSLPPRVAGCFVSKGSFQGHLTPLVK
Number of residues164
Molecular Weight18017.875
Theoretical pINot Available
GO Classification
Functions
  • DNA binding
Components
  • extracellular exosome
  • nucleosome
  • nucleus
General FunctionDna binding
Specific FunctionCore component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ6DRA6
UniProtKB Entry NameH2B2D_HUMAN
Cellular LocationNucleus
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:20517
Chromosome LocationNot Available
LocusNot Available
References
  1. Marzluff WF, Gongidi P, Woods KR, Jin J, Maltais LJ: The human and mouse replication-dependent histone genes. Genomics. 2002 Nov;80(5):487-98. 12408966
  2. Braastad CD, Hovhannisyan H, van Wijnen AJ, Stein JL, Stein GS: Functional characterization of a human histone gene cluster duplication. Gene. 2004 Nov 10;342(1):35-40. 15527963
  3. Cheung WL, Ajiro K, Samejima K, Kloc M, Cheung P, Mizzen CA, Beeser A, Etkin LD, Chernoff J, Earnshaw WC, Allis CD: Apoptotic phosphorylation of histone H2B is mediated by mammalian sterile twenty kinase. Cell. 2003 May 16;113(4):507-17. 12757711
  4. Golebiowski F, Kasprzak KS: Inhibition of core histones acetylation by carcinogenic nickel(II). Mol Cell Biochem. 2005 Nov;279(1-2):133-9. 16283522
  5. Tan M, Luo H, Lee S, Jin F, Yang JS, Montellier E, Buchou T, Cheng Z, Rousseaux S, Rajagopal N, Lu Z, Ye Z, Zhu Q, Wysocka J, Ye Y, Khochbin S, Ren B, Zhao Y: Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification. Cell. 2011 Sep 16;146(6):1016-28. doi: 10.1016/j.cell.2011.08.008. 21925322