NameCocaine- and amphetamine-regulated transcript protein
Synonyms
  • CART
Gene NameCARTPT
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010611|Cocaine- and amphetamine-regulated transcript protein
MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEV
LKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Number of residues116
Molecular Weight12828.975
Theoretical pI8.37
GO Classification
Processes
  • circadian regulation of gene expression
  • negative regulation of appetite
  • negative regulation of bone resorption
  • signal transduction
  • negative regulation of glucagon secretion
  • negative regulation of osteoclast differentiation
  • neuropeptide signaling pathway
  • positive regulation of epinephrine secretion
  • cell-cell signaling
  • somatostatin secretion
  • synaptic transmission
  • activation of MAPKK activity
  • G-protein coupled receptor signaling pathway
  • regulation of insulin secretion
  • positive regulation of blood pressure
  • positive regulation of transmission of nerve impulse
  • cellular response to starvation
  • adult feeding behavior
  • cellular glucose homeostasis
Components
  • extracellular space
  • secretory granule
General FunctionNot Available
Specific FunctionSatiety factor closely associated with the actions of leptin and neuropeptide y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. It promotes neuronal development and survival in vitro.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID609306
UniProtKB IDQ16568
UniProtKB Entry NameCART_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0010612|Cocaine- and amphetamine-regulated transcript protein (CARTPT)
ATGGAGAGCTCCCGCGTGAGGCTGCTGCCCCTCCTGGGCGCCGCCCTGCTGCTGATGCTA
CCTCTGTTGGGTACCCGTGCCCAGGAGGACGCCGAGCTCCAGCCCCGAGCCCTGGACATC
TACTCTGCCGTGGATGATGCCTCCCACGAGAAGGAGCTGATCGAAGCGCTGCAAGAAGTC
TTGAAGAAGCTCAAGAGTAAACGTGTTCCCATCTATGAGAAGAAGTATGGCCAAGTCCCC
ATGTGTGACGCCGGTGAGCAGTGTGCAGTGAGGAAAGGGGCAAGGATCGGGAAGCTGTGT
GACTGTCCCCGAGGAACCTCCTGCAATTCCTTCCTCCTGAAGTGCTTATGA
GenBank Gene IDU16826
GeneCard IDNot Available
GenAtlas IDCARTPT
HGNC IDHGNC:24323
Chromosome Location5
Locus5q13.2
References
  1. Douglass J, Daoud S: Characterization of the human cDNA and genomic DNA encoding CART: a cocaine- and amphetamine-regulated transcript. Gene. 1996 Mar 9;169(2):241-5. 8647455
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. 15340161
  4. Kristensen P, Judge ME, Thim L, Ribel U, Christjansen KN, Wulff BS, Clausen JT, Jensen PB, Madsen OD, Vrang N, Larsen PJ, Hastrup S: Hypothalamic CART is a new anorectic peptide regulated by leptin. Nature. 1998 May 7;393(6680):72-6. 9590691
  5. Ludvigsen S, Thim L, Blom AM, Wulff BS: Solution structure of the satiety factor, CART, reveals new functionality of a well-known fold. Biochemistry. 2001 Aug 7;40(31):9082-8. 11478874
  6. Challis BG, Yeo GS, Farooqi IS, Luan J, Aminian S, Halsall DJ, Keogh JM, Wareham NJ, O'Rahilly S: The CART gene and human obesity: mutational analysis and population genetics. Diabetes. 2000 May;49(5):872-5. 10905499
  7. del Giudice EM, Santoro N, Cirillo G, D'Urso L, Di Toro R, Perrone L: Mutational screening of the CART gene in obese children: identifying a mutation (Leu34Phe) associated with reduced resting energy expenditure and cosegregating with obesity phenotype in a large family. Diabetes. 2001 Sep;50(9):2157-60. 11522684