NameC-X-C motif chemokine 9
Synonyms
  • CMK
  • Gamma-interferon-induced monokine
  • HuMIG
  • MIG
  • Monokine induced by interferon-gamma
  • SCYB9
  • Small-inducible cytokine B9
Gene NameCXCL9
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017719|C-X-C motif chemokine 9
MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK
IEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR
QKKTT
Number of residues125
Molecular Weight14018.72
Theoretical pINot Available
GO Classification
Functions
  • cytokine activity
  • CXCR3 chemokine receptor binding
  • chemokine activity
Processes
  • positive regulation of cAMP-mediated signaling
  • signal transduction
  • chemokine-mediated signaling pathway
  • defense response to virus
  • positive regulation of myoblast differentiation
  • defense response
  • immune response
  • positive regulation of cAMP metabolic process
  • positive regulation of leukocyte chemotaxis
  • positive regulation of myoblast fusion
  • inflammatory response
  • T cell chemotaxis
  • cell-cell signaling
  • chemotaxis
  • regulation of cell proliferation
  • G-protein coupled receptor signaling pathway
  • positive regulation of release of sequestered calcium ion into cytosol
  • response to lipopolysaccharide
  • cellular defense response
Components
  • extracellular region
  • extracellular space
  • external side of plasma membrane
General FunctionCytokine activity
Specific FunctionCytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ07325
UniProtKB Entry NameCXCL9_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0017720|C-X-C motif chemokine 9 (CXCL9)
ATGAAGAAAAGTGGTGTTCTTTTCCTCTTGGGCATCATCTTGCTGGTTCTGATTGGAGTG
CAAGGAACCCCAGTAGTGAGAAAGGGTCGCTGTTCCTGCATCAGCACCAACCAAGGGACT
ATCCACCTACAATCCTTGAAAGACCTTAAACAATTTGCCCCAAGCCCTTCCTGCGAGAAA
ATTGAAATCATTGCTACACTGAAGAATGGAGTTCAAACATGTCTAAACCCAGATTCAGCA
GATGTGAAGGAACTGATTAAAAAGTGGGAGAAACAGGTCAGCCAAAAGAAAAAGCAAAAG
AATGGGAAAAAACATCAAAAAAAGAAAGTTCTGAAAGTTCGAAAATCTCAACGTTCTCGT
CAAAAGAAGACTACATAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:7098
Chromosome Location4
LocusNot Available
References
  1. Farber JM: HuMig: a new human member of the chemokine family of cytokines. Biochem Biophys Res Commun. 1993 Apr 15;192(1):223-30. 8476424
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Tensen CP, Flier J, Van Der Raaij-Helmer EM, Sampat-Sardjoepersad S, Van Der Schors RC, Leurs R, Scheper RJ, Boorsma DM, Willemze R: Human IP-9: A keratinocyte-derived high affinity CXC-chemokine ligand for the IP-10/Mig receptor (CXCR3). J Invest Dermatol. 1999 May;112(5):716-22. 10233762