Lysozyme C

NameLysozyme C
Synonyms
  • 1,4-beta-N-acetylmuramidase C
  • 3.2.1.17
  • LZM
Gene NameLYZ
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009332|Lysozyme C
MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRA
TNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRD
PQGIRAWVAWRNRCQNRDVRQYVQGCGV
Number of residues148
Molecular Weight16536.885
Theoretical pINot Available
GO Classification
Functions
  • lysozyme activity
  • identical protein binding
Processes
  • cellular protein metabolic process
  • defense response to bacterium
  • cytolysis
  • retina homeostasis
  • inflammatory response
Components
  • extracellular region
  • extracellular space
  • extracellular exosome
General FunctionLysozyme activity
Specific FunctionLysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP61626
UniProtKB Entry NameLYSC_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0021695|Lysozyme C (LYZ)
ATGAAGGCTCTCATTGTTCTGGGGCTTGTCCTCCTTTCTGTTACGGTCCAGGGCAAGGTC
TTTGAAAGGTGTGAGTTGGCCAGAACTCTGAAAAGATTGGGAATGGATGGCTACAGGGGA
ATCAGCCTAGCAAACTGGATGTGTTTGGCCAAATGGGAGAGTGGTTACAACACACGAGCT
ACAAACTACAATGCTGGAGACAGAAGCACTGATTATGGGATATTTCAGATCAATAGCCGC
TACTGGTGTAATGATGGCAAAACCCCAGGAGCAGTTAATGCCTGTCATTTATCCTGCAGT
GCTTTGCTGCAAGATAACATCGCTGATGCTGTAGCTTGTGCAAAGAGGGTTGTCCGTGAT
CCACAAGGCATTAGAGCATGGGTGGCATGGAGAAATCGTTGTCAAAACAGAGATGTCCGT
CAGTATGTTCAAGGTTGTGGAGTGTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:6740
Chromosome Location12
LocusNot Available
References
  1. Castanon MJ, Spevak W, Adolf GR, Chlebowicz-Sledziewska E, Sledziewski A: Cloning of human lysozyme gene and expression in the yeast Saccharomyces cerevisiae. Gene. 1988 Jun 30;66(2):223-34. 2971592
  2. Chung LP, Keshav S, Gordon S: Cloning the human lysozyme cDNA: inverted Alu repeat in the mRNA and in situ hybridization for macrophages and Paneth cells. Proc Natl Acad Sci U S A. 1988 Sep;85(17):6227-31. 3413092
  3. Yoshimura K, Toibana A, Nakahama K: Human lysozyme: sequencing of a cDNA, and expression and secretion by Saccharomyces cerevisiae. Biochem Biophys Res Commun. 1988 Jan 29;150(2):794-801. 2829884
  4. Peters CW, Kruse U, Pollwein R, Grzeschik KH, Sippel AE: The human lysozyme gene. Sequence organization and chromosomal localization. Eur J Biochem. 1989 Jul 1;182(3):507-16. 2546758
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Canfield RE, Kammerman S, Sobel JH, Morgan FJ: Primary structure of lysozymes from man and goose. Nat New Biol. 1971 Jul 7;232(27):16-7. 5284421
  7. Thomsen J, Lund EH, Kristiansen K, Brunfeldt K, Malmquist J: A val-val sequence found in a human monocytic leukemia lysozyme. FEBS Lett. 1972 Apr 15;22(1):34-36. 11946554
  8. Jolles J, Jolles P: Human milk lysozyme: unpublished data concerning the establishment of the complete primary structure; comparison with lysozymes of various origins. Helv Chim Acta. 1971;54(8):2668-75. 5168859
  9. Jolles J, Jolles P: Comparison between human and bird lysozymes: Note concerning the previously observed deletion. FEBS Lett. 1972 Apr 15;22(1):31-33. 11946553
  10. Azkargorta M, Soria J, Ojeda C, Guzman F, Acera A, Iloro I, Suarez T, Elortza F: Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification. J Proteome Res. 2015 Jun 5;14(6):2649-58. doi: 10.1021/acs.jproteome.5b00179. Epub 2015 May 20. 25946035
  11. Kanaya E, Ishihara K, Tsunasawa S, Nokihara K, Kikuchi M: Indication of possible post-translational formation of disulphide bonds in the beta-sheet domain of human lysozyme. Biochem J. 1993 Jun 1;292 ( Pt 2):469-76. 8503881
  12. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  13. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712
  14. Artymiuk PJ, Blake CC: Refinement of human lysozyme at 1.5 A resolution analysis of non-bonded and hydrogen-bond interactions. J Mol Biol. 1981 Nov 15;152(4):737-62. 7334520
  15. Blake CC, Pulford WC, Artymiuk PJ: X-ray studies of water in crystals of lysozyme. J Mol Biol. 1983 Jul 5;167(3):693-723. 6876162
  16. Inaka K, Taniyama Y, Kikuchi M, Morikawa K, Matsushima M: The crystal structure of a mutant human lysozyme C77/95A with increased secretion efficiency in yeast. J Biol Chem. 1991 Jul 5;266(19):12599-603. 2061330
  17. Steinrauf LK: Structures of monoclinic lysozyme iodide at 1.6 A and of triclinic lysozyme nitrate at 1.1 A. Acta Crystallogr D Biol Crystallogr. 1998 Sep 1;54(Pt 5):767-80. 9757091
  18. Redfield C, Dobson CM: 1H NMR studies of human lysozyme: spectral assignment and comparison with hen lysozyme. Biochemistry. 1990 Aug 7;29(31):7201-14. 2207098
  19. : . ;():. 1794972
  20. Pepys MB, Hawkins PN, Booth DR, Vigushin DM, Tennent GA, Soutar AK, Totty N, Nguyen O, Blake CC, Terry CJ, et al.: Human lysozyme gene mutations cause hereditary systemic amyloidosis. Nature. 1993 Apr 8;362(6420):553-7. 8464497