NameDNA-directed RNA polymerases I, II, and III subunit RPABC2
Synonyms
  • DNA-directed RNA polymerase II subunit F
  • DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide
  • POLRF
  • RNA polymerases I, II, and III subunit ABC2
  • RPABC14.4
  • RPB14.4
  • RPB6 homolog
  • RPC15
Gene NamePOLR2F
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013575|DNA-directed RNA polymerases I, II, and III subunit RPABC2
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIITD
Number of residues127
Molecular Weight14477.92
Theoretical pINot Available
GO Classification
Functions
  • DNA-directed RNA polymerase activity
  • DNA binding
Processes
  • positive regulation of type I interferon production
  • DNA repair
  • transcription initiation from RNA polymerase I promoter
  • 7-methylguanosine mRNA capping
  • gene silencing by RNA
  • nucleotide-excision repair
  • mRNA splicing, via spliceosome
  • transcription from RNA polymerase II promoter
  • piRNA metabolic process
  • positive regulation of viral transcription
  • gene expression
  • transcription initiation from RNA polymerase II promoter
  • RNA splicing
  • transcription elongation from RNA polymerase II promoter
  • innate immune response
  • termination of RNA polymerase I transcription
  • somatic stem cell population maintenance
  • termination of RNA polymerase III transcription
  • transcription-coupled nucleotide-excision repair
  • transcription elongation from RNA polymerase I promoter
  • viral process
  • transcription elongation from RNA polymerase III promoter
  • negative regulation of gene expression, epigenetic
  • transcription from RNA polymerase I promoter
  • regulation of gene expression, epigenetic
  • transcription from RNA polymerase III promoter
Components
  • DNA-directed RNA polymerase II, core complex
  • cytosol
  • nucleolus
  • DNA-directed RNA polymerase I complex
  • nucleoplasm
  • DNA-directed RNA polymerase III complex
  • nucleus
General FunctionDna-directed rna polymerase activity
Specific FunctionDNA-dependent RNA polymerases catalyze the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II, and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2F/RPB6 is part of the clamp element and together with parts of RPB1 and RPB2 forms a pocket to which the RPB4-RPB7 subcomplex binds (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP61218
UniProtKB Entry NameRPAB2_HUMAN
Cellular LocationNucleus
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9193
Chromosome LocationNot Available
LocusNot Available
References
  1. Acker J, Wintzerith M, Vigneron M, Kedinger C: A 14.4 KDa acidic subunit of human RNA polymerase II with a putative leucine-zipper. DNA Seq. 1994;4(5):329-31. 7803819
  2. Pusch C, Wang Z, Roe B, Blin N: Genomic structure of the RNA polymerase II small subunit (hRPB14.4) locus (POLRF) and mapping to 22q13.1 by sequence identity. Genomics. 1996 Jun 15;34(3):440-2. 8786150
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. 15461802
  4. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. 10591208
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Kershnar E, Wu SY, Chiang CM: Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes. J Biol Chem. 1998 Dec 18;273(51):34444-53. 9852112
  7. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  8. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  9. del Rio-Portilla F, Gaskell A, Gilbert D, Ladias JA, Wagner G: Solution structure of the hRPABC14.4 subunit of human RNA polymerases. Nat Struct Biol. 1999 Nov;6(11):1039-42. 10542096
  10. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974