NameAcidic phospholipase A2 3
Synonyms
  • 3.1.1.4
  • Phosphatidylcholine 2-acylhydrolase
  • svPLA2
Gene NameNot Available
OrganismAndaman cobra
Amino acid sequence
>lcl|BSEQ0019715|Acidic phospholipase A2 3
SNRPMPLNLYQFKNMIQCTVPSRSWQDFADYGCYCGKGGSGTPVDDLDRCCQVHDNCYNE
AENISGCRPYFKTYSYECTQGTLTCKGDNNACAASVCDCDRLAAICFAGAPYNDANYNID
LKARCN
Number of residues126
Molecular Weight13968.385
Theoretical pINot Available
GO Classification
Functions
  • phospholipase A2 activity
  • calcium ion binding
Processes
  • phospholipid metabolic process
  • lipid catabolic process
Components
  • extracellular region
General FunctionPhospholipase a2 activity
Specific FunctionPLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP60045
UniProtKB Entry NamePA2A3_NAJSG
Cellular LocationSecreted
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDNot Available
Chromosome LocationNot Available
LocusNot Available
References
  1. Singh RK, Vikram P, Makker J, Jabeen T, Sharma S, Dey S, Kaur P, Srinivasan A, Singh TP: Design of specific peptide inhibitors for group I phospholipase A2: structure of a complex formed between phospholipase A2 from Naja naja sagittifera (group I) and a designed peptide inhibitor Val-Ala-Phe-Arg-Ser (VAFRS) at 1.9 A resolution reveals unique features. Biochemistry. 2003 Oct 14;42(40):11701-6. 14529280
  2. Singh RK, Ethayathulla AS, Jabeen T, Sharma S, Kaur P, Singh TP: Aspirin induces its anti-inflammatory effects through its specific binding to phospholipase A2: crystal structure of the complex formed between phospholipase A2 and aspirin at 1.9 angstroms resolution. J Drug Target. 2005 Feb;13(2):113-9. 15823962