T3DB: Neurexin-1-beta

Name	Neurexin-1-beta
Synonyms	Neurexin I-beta
Gene Name	NRXN1
Organism	Human
Amino acid sequence	>lcl\|BSEQ0009039\|Neurexin-1-beta MYQRMLRCGAELGSPGGGGGGGGGGGAGGRLALLWIVPLTLSGLLGVAWGASSLGAHHIH HFHGSSKHHSVPIAIYRSPASLRGGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIG FSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVV RFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGL KVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATSTARR GKPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIR ESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKE KQPSSAKSSNKNKKNKDKEYYV
Number of residues	442
Molecular Weight	46860.215
Theoretical pI	Not Available
GO Classification	Functions metal ion binding calcium-dependent protein binding cell adhesion molecule binding neuroligin family protein binding transmembrane signaling receptor activity receptor binding Processes positive regulation of excitatory postsynaptic potential presynaptic membrane assembly gamma-aminobutyric acid receptor clustering gephyrin clustering involved in postsynaptic density assembly establishment of protein localization neuroligin clustering involved in postsynaptic membrane assembly neuron cell-cell adhesion postsynaptic density protein 95 clustering heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules postsynaptic membrane assembly positive regulation of synaptic transmission, glutamatergic calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules regulation of N-methyl-D-aspartate selective glutamate receptor activity angiogenesis cerebellar granule cell differentiation negative regulation of filopodium assembly guanylate kinase-associated protein clustering learning NMDA glutamate receptor clustering neuronal signal transduction social behavior protein complex assembly involved in synapse maturation positive regulation of establishment of protein localization to plasma membrane synaptic vesicle clustering signal transduction protein localization to synapse receptor localization to synapse adult behavior vocalization behavior synapse assembly regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity Components cell surface vesicle cell junction integral component of membrane nuclear membrane endocytic vesicle axonal growth cone neuronal cell body presynaptic membrane endoplasmic reticulum plasma membrane
General Function	Transmembrane signaling receptor activity
Specific Function	Neuronal cell surface protein that may be involved in cell recognition and cell adhesion by forming intracellular junctions through binding to neuroligins. May play a role in formation or maintenance of synaptic junctions. May mediate intracellular signaling. May play a role in angiogenesis (By similarity).
Pfam Domain Function	Laminin_G_2 (PF02210 ) Syndecan (PF01034 )
Transmembrane Regions	364-386
GenBank Protein ID	Not Available
UniProtKB ID	P58400
UniProtKB Entry Name	NRX1B_HUMAN
Cellular Location	Cell membrane
Gene sequence	Not Available
GenBank Gene ID	Not Available
GeneCard ID	Not Available
GenAtlas ID	Not Available
HGNC ID	HGNC:8008
Chromosome Location	Not Available
Locus	Not Available
References	Kleiderlein JJ, Nisson PE, Jessee J, Li WB, Becker KG, Derby ML, Ross CA, Margolis RL: CCG repeats in cDNAs from human brain. Hum Genet. 1998 Dec;103(6):666-73. 9921901 Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621 Chen X, Liu H, Shim AH, Focia PJ, He X: Structural basis for synaptic adhesion mediated by neuroligin-neurexin interactions. Nat Struct Mol Biol. 2008 Jan;15(1):50-6. Epub 2007 Dec 16. 18084303