T3DB: DNA-directed RNA polymerases I, II, and III subunit RPABC4

Name	DNA-directed RNA polymerases I, II, and III subunit RPABC4
Synonyms	ABC10-alpha DNA-directed RNA polymerase II subunit K RNA polymerase II 7.0 kDa subunit RNA polymerases I, II, and III subunit ABC4 RPB10alpha RPB7.0
Gene Name	POLR2K
Organism	Human
Amino acid sequence	>lcl\|BSEQ0013654\|DNA-directed RNA polymerases I, II, and III subunit RPABC4 MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
Number of residues	58
Molecular Weight	7004.145
Theoretical pI	Not Available
GO Classification	Functions zinc ion binding DNA binding DNA-directed RNA polymerase activity Processes transcription elongation from RNA polymerase I promoter transcription-coupled nucleotide-excision repair transcription elongation from RNA polymerase III promoter viral process transcription from RNA polymerase I promoter negative regulation of gene expression, epigenetic transcription from RNA polymerase III promoter regulation of gene expression, epigenetic transcription initiation from RNA polymerase I promoter positive regulation of type I interferon production DNA repair regulation of transcription from RNA polymerase I promoter 7-methylguanosine mRNA capping gene silencing by RNA nucleotide-excision repair mRNA splicing, via spliceosome transcription from RNA polymerase II promoter piRNA metabolic process positive regulation of viral transcription gene expression RNA splicing transcription initiation from RNA polymerase II promoter transcription elongation from RNA polymerase II promoter termination of RNA polymerase I transcription innate immune response termination of RNA polymerase III transcription somatic stem cell population maintenance Components nucleus DNA-directed RNA polymerase II, core complex DNA-directed RNA polymerase I complex cytosol DNA-directed RNA polymerase III complex nucleoplasm
General Function	Zinc ion binding
Specific Function	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively.
Pfam Domain Function	DNA_RNApol_7kD (PF03604 )
Transmembrane Regions	Not Available
GenBank Protein ID	Not Available
UniProtKB ID	P53803
UniProtKB Entry Name	RPAB4_HUMAN
Cellular Location	Nucleus
Gene sequence	>lcl\|BSEQ0013655\|DNA-directed RNA polymerases I, II, and III subunit RPABC4 (POLR2K) ATGGACACCCAGAAGGACGTTCAACCTCCAAAGCAGCAACCAATGATATATATCTGTGGA GAGTGTCACACAGAAAATGAAATAAAATCTAGGGATCCAATCAGATGCAGAGAATGTGGA TACAGAATAATGTACAAGAAAAGGACTAAAAGATTGGTCGTTTTTGATGCTCGATGA
GenBank Gene ID	Not Available
GeneCard ID	Not Available
GenAtlas ID	Not Available
HGNC ID	HGNC:9198
Chromosome Location	8
Locus	Not Available
References	Shpakovski GV, Acker J, Wintzerith M, Lacroix JF, Thuriaux P, Vigneron M: Four subunits that are shared by the three classes of RNA polymerase are functionally interchangeable between Homo sapiens and Saccharomyces cerevisiae. Mol Cell Biol. 1995 Sep;15(9):4702-10. 7651387 Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334