NameInsulin-like growth factor-binding protein 5
Synonyms
  • IBP-5
  • IBP5
Gene NameIGFBP5
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013805|Insulin-like growth factor-binding protein 5
MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA
PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
Number of residues272
Molecular Weight30569.985
Theoretical pINot Available
GO Classification
Functions
  • insulin-like growth factor I binding
  • insulin-like growth factor II binding
  • fibronectin binding
Processes
  • type B pancreatic cell proliferation
  • mammary gland involution
  • negative regulation of osteoblast differentiation
  • cellular response to cAMP
  • striated muscle cell differentiation
  • positive regulation of protein kinase B signaling
  • skeletal muscle tissue growth
  • regulation of glucose metabolic process
  • signal transduction
  • response to growth hormone
  • negative regulation of smooth muscle cell proliferation
  • negative regulation of insulin-like growth factor receptor signaling pathway
  • lung alveolus development
  • negative regulation of muscle tissue development
  • cellular response to organic cyclic compound
  • regulation of cell growth
  • negative regulation of skeletal muscle hypertrophy
  • hair follicle morphogenesis
  • glucose homeostasis
  • negative regulation of growth
  • glucose metabolic process
  • osteoblast differentiation
  • cellular protein metabolic process
  • negative regulation of translation
  • intracellular signal transduction
  • female pregnancy
  • negative regulation of cell migration
  • positive regulation of insulin-like growth factor receptor signaling pathway
  • negative regulation of smooth muscle cell migration
Components
  • intracellular
  • extracellular region
  • extracellular space
  • insulin-like growth factor binding protein complex
  • insulin-like growth factor ternary complex
General FunctionInsulin-like growth factor ii binding
Specific FunctionIGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP24593
UniProtKB Entry NameIBP5_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0013806|Insulin-like growth factor-binding protein 5 (IGFBP5)
ATGGTGTTGCTCACCGCGGTCCTCCTGCTGCTGGCCGCCTATGCGGGGCCGGCCCAGAGC
CTGGGCTCCTTCGTGCACTGCGAGCCCTGCGACGAGAAAGCCCTCTCCATGTGCCCCCCC
AGCCCCCTGGGCTGCGAGCTGGTCAAGGAGCCGGGCTGCGGCTGCTGCATGACCTGCGCC
CTGGCCGAGGGGCAGTCGTGCGGCGTCTACACCGAGCGCTGCGCCCAGGGGCTGCGCTGC
CTCCCCCGGCAGGACGAGGAGAAGCCGCTGCACGCCCTGCTGCACGGCCGCGGGGTTTGC
CTCAACGAAAAGAGCTACCGCGAGCAAGTCAAGATCGAGAGAGACTCCCGTGAGCACGAG
GAGCCCACCACCTCTGAGATGGCCGAGGAGACCTACTCCCCCAAGATCTTCCGGCCCAAA
CACACCCGCATCTCCGAGCTGAAGGCTGAAGCAGTGAAGAAGGACCGCAGAAAGAAGCTG
ACCCAGTCCAAGTTTGTCGGGGGAGCCGAGAACACTGCCCACCCCCGGATCATCTCTGCA
CCTGAGATGAGACAGGAGTCTGAGCAGGGCCCCTGCCGCAGACACATGGAGGCTTCCCTG
CAGGAGCTCAAAGCCAGCCCACGCATGGTGCCCCGTGCTGTGTACCTGCCCAATTGTGAC
CGCAAAGGATTCTACAAGAGAAAGCAGTGCAAACCTTCCCGTGGCCGCAAGCGTGGCATC
TGCTGGTGCGTGGACAAGTACGGGATGAAGCTGCCAGGCATGGAGTACGTTGACGGGGAC
TTTCAGTGCCACACCTTCGACAGCAGCAACGTTGAGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:5474
Chromosome Location2
LocusNot Available
References
  1. Kiefer MC, Ioh RS, Bauer DM, Zapf J: Molecular cloning of a new human insulin-like growth factor binding protein. Biochem Biophys Res Commun. 1991 Apr 15;176(1):219-25. 1850258
  2. Shimasaki S, Shimonaka M, Zhang HP, Ling N: Identification of five different insulin-like growth factor binding proteins (IGFBPs) from adult rat serum and molecular cloning of a novel IGFBP-5 in rat and human. J Biol Chem. 1991 Jun 5;266(16):10646-53. 1709938
  3. Allander SV, Larsson C, Ehrenborg E, Suwanichkul A, Weber G, Morris SL, Bajalica S, Kiefer MC, Luthman H, Powell DR: Characterization of the chromosomal gene and promoter for human insulin-like growth factor binding protein-5. J Biol Chem. 1994 Apr 8;269(14):10891-8. 7511611
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Andress DL, Birnbaum RS: A novel human insulin-like growth factor binding protein secreted by osteoblast-like cells. Biochem Biophys Res Commun. 1991 Apr 15;176(1):213-8. 1850257
  6. Standker L, Wobst P, Mark S, Forssmann WG: Isolation and characterization of circulating 13-kDa C-terminal fragments of human insulin-like growth factor binding protein-5. FEBS Lett. 1998 Dec 18;441(2):281-6. 9883900
  7. Nili M, Mukherjee A, Shinde U, David L, Rotwein P: Defining the disulfide bonds of insulin-like growth factor-binding protein-5 by tandem mass spectrometry with electron transfer dissociation and collision-induced dissociation. J Biol Chem. 2012 Jan 6;287(2):1510-9. doi: 10.1074/jbc.M111.285528. Epub 2011 Nov 22. 22117064
  8. Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE: A Single Kinase Generates the Majority of the Secreted Phosphoproteome. Cell. 2015 Jun 18;161(7):1619-32. doi: 10.1016/j.cell.2015.05.028. 26091039
  9. Kalus W, Zweckstetter M, Renner C, Sanchez Y, Georgescu J, Grol M, Demuth D, Schumacher R, Dony C, Lang K, Holak TA: Structure of the IGF-binding domain of the insulin-like growth factor-binding protein-5 (IGFBP-5): implications for IGF and IGF-I receptor interactions. EMBO J. 1998 Nov 16;17(22):6558-72. 9822601