NameArachidonate 5-lipoxygenase-activating protein
Synonyms
  • FLAP
  • MK-886-binding protein
Gene NameALOX5AP
OrganismHuman
Amino acid sequence
>lcl|BSEQ0011708|Arachidonate 5-lipoxygenase-activating protein
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Number of residues161
Molecular Weight18156.96
Theoretical pI8.64
GO Classification
Functions
  • protein N-terminus binding
  • arachidonic acid binding
  • enzyme activator activity
Processes
  • cellular response to calcium ion
  • arachidonic acid metabolic process
  • leukotriene metabolic process
  • lipoxin metabolic process
  • lipoxygenase pathway
  • protein homotrimerization
  • small molecule metabolic process
  • leukotriene biosynthetic process
Components
  • nuclear envelope
  • membrane
  • endoplasmic reticulum
  • endoplasmic reticulum membrane
  • integral component of membrane
  • nuclear membrane
General FunctionProtein n-terminus binding
Specific FunctionRequired for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.
Pfam Domain Function
Transmembrane Regions9-30 53-77 81-102 116-128
GenBank Protein IDNot Available
UniProtKB IDP20292
UniProtKB Entry NameAL5AP_HUMAN
Cellular LocationNucleus membrane
Gene sequence
>lcl|BSEQ0011709|Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)
ATGCTCACATTTAATCACGATGCTCCCTGGCATACACAGAAGACTCTGAAAACTTCTGAA
TTTGGGAAATCCTTTGGCACCTTGGGGCACATTGGGAACATAAGCCATCAGTGCTGGGCA
GGTTGTGCAGCTGGAGGCAGAGCAGTCCTCTCTGGGGAGCCTGAAGCAAACATGGATCAA
GAAACTGTAGGCAATGTTGTCCTGTTGGCCATCGTCACCCTCATCAGCGTGGTCCAGAAT
GGATTCTTTGCCCATAAAGTGGAGCACGAAAGCAGGACCCAGAATGGGAGGAGCTTCCAG
AGGACCGGAACACTTGCCTTTGAGCGGGTCTACACTGCCAACCAGAACTGTGTAGATGCG
TACCCCACTTTCCTCGCTGTGCTCTGGTCTGCGGGGCTACTTTGCAGCCAAGTTCCTGCT
GCGTTTGCTGGACTGATGTACTTGTTTGTGAGGCAAAAGTACTTTGTCGGTTACCTAGGA
GAGAGAACGCAGAGCACCCCTGGCTACATATTTGGGAAACGCATCATACTCTTCCTGTTC
CTCATGTCCGTTGCTGGCATATTCAACTATTACCTCATCTTCTTTTTCGGAAGTGACTTT
GAAAACTACATAAAGACGATCTCCACCACCATCTCCCCTCTACTTCTCATTCCCTAA
GenBank Gene IDX52195
GeneCard IDNot Available
GenAtlas IDALOX5AP
HGNC IDHGNC:436
Chromosome Location13
Locus13q12
References
  1. Dixon RA, Diehl RE, Opas E, Rands E, Vickers PJ, Evans JF, Gillard JW, Miller DK: Requirement of a 5-lipoxygenase-activating protein for leukotriene synthesis. Nature. 1990 Jan 18;343(6255):282-4. 2300173
  2. Kennedy BP, Diehl RE, Boie Y, Adam M, Dixon RA: Gene characterization and promoter analysis of the human 5-lipoxygenase-activating protein (FLAP). J Biol Chem. 1991 May 5;266(13):8511-6. 1673682
  3. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. 15057823
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Mancini JA, Abramovitz M, Cox ME, Wong E, Charleson S, Perrier H, Wang Z, Prasit P, Vickers PJ: 5-lipoxygenase-activating protein is an arachidonate binding protein. FEBS Lett. 1993 Mar 8;318(3):277-81. 8440384
  6. Woods JW, Evans JF, Ethier D, Scott S, Vickers PJ, Hearn L, Heibein JA, Charleson S, Singer II: 5-lipoxygenase and 5-lipoxygenase-activating protein are localized in the nuclear envelope of activated human leukocytes. J Exp Med. 1993 Dec 1;178(6):1935-46. 8245774
  7. Helgadottir A, Manolescu A, Thorleifsson G, Gretarsdottir S, Jonsdottir H, Thorsteinsdottir U, Samani NJ, Gudmundsson G, Grant SF, Thorgeirsson G, Sveinbjornsdottir S, Valdimarsson EM, Matthiasson SE, Johannsson H, Gudmundsdottir O, Gurney ME, Sainz J, Thorhallsdottir M, Andresdottir M, Frigge ML, Topol EJ, Kong A, Gudnason V, Hakonarson H, Gulcher JR, Stefansson K: The gene encoding 5-lipoxygenase activating protein confers risk of myocardial infarction and stroke. Nat Genet. 2004 Mar;36(3):233-9. Epub 2004 Feb 8. 14770184
  8. Koch W, Hoppmann P, Mueller JC, Schomig A, Kastrati A: No association of polymorphisms in the gene encoding 5-lipoxygenase-activating protein and myocardial infarction in a large central European population. Genet Med. 2007 Feb;9(2):123-9. 17304054
  9. Strid T, Svartz J, Franck N, Hallin E, Ingelsson B, Soderstrom M, Hammarstrom S: Distinct parts of leukotriene C(4) synthase interact with 5-lipoxygenase and 5-lipoxygenase activating protein. Biochem Biophys Res Commun. 2009 Apr 17;381(4):518-22. doi: 10.1016/j.bbrc.2009.02.074. Epub 2009 Feb 20. 19233132
  10. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  11. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712
  12. Ferguson AD, McKeever BM, Xu S, Wisniewski D, Miller DK, Yamin TT, Spencer RH, Chu L, Ujjainwalla F, Cunningham BR, Evans JF, Becker JW: Crystal structure of inhibitor-bound human 5-lipoxygenase-activating protein. Science. 2007 Jul 27;317(5837):510-2. Epub 2007 Jun 28. 17600184