Cytochrome c oxidase subunit 7C, mitochondrial

NameCytochrome c oxidase subunit 7C, mitochondrial
Synonyms
  • Cytochrome c oxidase polypeptide VIIc
Gene NameCOX7C
OrganismHuman
Amino acid sequence
>lcl|BSEQ0012779|Cytochrome c oxidase subunit 7C, mitochondrial
MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL
LKT
Number of residues63
Molecular Weight7245.45
Theoretical pI10.88
GO Classification
Functions
  • cytochrome-c oxidase activity
Processes
  • small molecule metabolic process
  • transcription initiation from RNA polymerase II promoter
  • cellular metabolic process
  • respiratory electron transport chain
  • generation of precursor metabolites and energy
  • gene expression
Components
  • mitochondrion
  • mitochondrial inner membrane
  • integral component of membrane
General FunctionCytochrome-c oxidase activity
Specific FunctionThis protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Pfam Domain Function
Transmembrane Regions34-60
GenBank Protein ID30155
UniProtKB IDP15954
UniProtKB Entry NameCOX7C_HUMAN
Cellular LocationMitochondrion inner membrane
Gene sequence
>lcl|BSEQ0012780|Cytochrome c oxidase subunit 7C, mitochondrial (COX7C)
ATGTTGGGCCAGAGCATCCGGAGGTTCACAACCTCTGTGGTCCGTAGGAGCCACTATGAG
GAGGGCCCTGGGAAGAATTTGCCATTTTCAGTGGAAAACAAGTGGTCGTTACTAGCTAAG
ATGTGTTTGTACTTTGGATCTGCATTTGCTACACCCTTCCTTGTAGTAAGACACCAACTG
CTTAAAACATAA
GenBank Gene IDX16560
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:2292
Chromosome Location5
Locus5q14
References
  1. Koga Y, Fabrizi GM, Mita S, Arnaudo E, Lomax MI, Aqua MS, Grossman LI, Schon EA: Sequence of a cDNA specifying subunit VIIc of human cytochrome c oxidase. Nucleic Acids Res. 1990 Feb 11;18(3):684. 2155413
  2. Hofmann S, Lichtner P, Schuffenhauer S, Gerbitz KD, Meitinger T: Assignment of the human genes coding for cytochrome c oxidase subunits Va (COX5A), VIc (COX6C) and VIIc (COX7C) to chromosome bands 15q25, 8q22-->q23 and 5q14 and of three pseudogenes (COX5AP1, COX6CP1, COX7CP1) to 14q22, 16p12 and 13q14-->q21 by FISH and radiation hybrid mapping. Cytogenet Cell Genet. 1998;83(3-4):226-7. 10072584
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Van Kuilenburg AB, Van Beeumen JJ, Van der Meer NM, Muijsers AO: Subunits VIIa,b,c of human cytochrome c oxidase. Identification of both 'heart-type' and 'liver-type' isoforms of subunit VIIa in human heart. Eur J Biochem. 1992 Jan 15;203(1-2):193-9. 1309697
  5. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  6. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712