Cytochrome b-c1 complex subunit 7

NameCytochrome b-c1 complex subunit 7
Synonyms
  • Complex III subunit 7
  • Complex III subunit VII
  • QP-C
  • Ubiquinol-cytochrome c reductase complex 14 kDa protein
  • UQBP
Gene NameUQCRB
OrganismHuman
Amino acid sequence
>lcl|BSEQ0007397|Cytochrome b-c1 complex subunit 7
MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRM
FRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
Number of residues111
Molecular Weight13530.34
Theoretical pI9.23
GO Classification
Processes
  • mitochondrial electron transport, ubiquinol to cytochrome c
  • small molecule metabolic process
  • cellular metabolic process
  • oxidation-reduction process
  • respiratory electron transport chain
  • oxidative phosphorylation
  • aerobic respiration
Components
  • mitochondrial respiratory chain
  • mitochondrial respiratory chain complex III
  • mitochondrial inner membrane
General FunctionNot Available
Specific FunctionThis is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID37580
UniProtKB IDP14927
UniProtKB Entry NameQCR7_HUMAN
Cellular LocationMitochondrion inner membrane
Gene sequence
>lcl|BSEQ0012692|Cytochrome b-c1 complex subunit 7 (UQCRB)
ATGCGAGATGATACAATATACGAGGATGAAGATGTAAAAGAAGCCATAAGAAGACTTCCT
GAGAACCTTTATAATGACAGGATGTTTCGCATTAAGAGGGCACTGGACCTGAACTTGAAG
CATCAGATCTTGCCTAAAGAGCAGTGGACCAAATATGAAGAGGAAAATTTCTACCTTGAA
CCGTATCTGAAAGAGGTTATTCGGGAAAGAAAAGAAAGAGAAGAATGGGCAAAGAAGTAA
GenBank Gene IDX13585
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:12582
Chromosome Location8
Locus8q22
References
  1. Suzuki H, Hosokawa Y, Toda H, Nishikimi M, Ozawa T: Cloning and sequencing of a cDNA for human mitochondrial ubiquinone-binding protein of complex III. Biochem Biophys Res Commun. 1988 Oct 31;156(2):987-94. 3056408
  2. Suzuki H, Hosokawa Y, Toda H, Nishikimi M, Ozawa T: Isolation of a single nuclear gene encoding human ubiquinone-binding protein in complex III of mitochondrial respiratory chain. Biochem Biophys Res Commun. 1989 May 30;161(1):371-8. 2543413
  3. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. 16421571
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Suzuki H, Hosokawa Y, Toda H, Nishikimi M, Ozawa T: Common protein-binding sites in the 5'-flanking regions of human genes for cytochrome c1 and ubiquinone-binding protein. J Biol Chem. 1990 May 15;265(14):8159-63. 2159470
  6. Haut S, Brivet M, Touati G, Rustin P, Lebon S, Garcia-Cazorla A, Saudubray JM, Boutron A, Legrand A, Slama A: A deletion in the human QP-C gene causes a complex III deficiency resulting in hypoglycaemia and lactic acidosis. Hum Genet. 2003 Jul;113(2):118-22. Epub 2003 Apr 23. 12709789
  7. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  8. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  9. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712