NamePlatelet glycoprotein IX
Synonyms
  • Glycoprotein 9
  • GP-IX
Gene NameGP9
OrganismHuman
Amino acid sequence
>lcl|BSEQ0016233|Platelet glycoprotein IX
MPAWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALPARTRHLLLAN
NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAA
HGPLGRLTGYQLGSCGWQLQASWVRPGVLWDVALVAVAALGLALLAGLLCATTEALD
Number of residues177
Molecular Weight19045.87
Theoretical pI6.32
GO Classification
Processes
  • cell adhesion
  • blood coagulation
  • platelet activation
  • blood coagulation, intrinsic pathway
Components
  • plasma membrane
  • integral component of plasma membrane
General FunctionNot Available
Specific FunctionThe GPIb-V-IX complex functions as the vWF receptor and mediates vWF-dependent platelet adhesion to blood vessels. The adhesion of platelets to injured vascular surfaces in the arterial circulation is a critical initiating event in hemostasis. GP-IX may provide for membrane insertion and orientation of GP-Ib.
Pfam Domain Function
Transmembrane Regions148-168
GenBank Protein ID2160046
UniProtKB IDP14770
UniProtKB Entry NameGPIX_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0016234|Platelet glycoprotein IX (GP9)
ATGCCTGCCTGGGGAGCCCTGTTCCTGCTCTGGGCCACAGCAGAGGCCACCAAGGACTGC
CCCAGCCCATGTACCTGCCGCGCCCTGGAAACCATGGGGCTGTGGGTGGACTGCAGGGGC
CACGGACTCACGGCCCTGCCTGCCCTGCCGGCCCGCACCCGCCACCTTCTGCTGGCCAAC
AACAGCCTTCAGTCCGTGCCCCCGGGAGCCTTTGACCACCTGCCCCAGCTGCAGACCCTC
GATGTGACGCAGAACCCCTGGCACTGTGACTGCAGCCTCACCTATCTGCGCCTCTGGCTG
GAGGACCGCACGCCCGAGGCCCTGCTGCAGGTCCGCTGTGCCAGCCCCAGCCTCGCTGCC
CATGGCCCGCTGGGCCGGCTGACAGGCTACCAGCTGGGCAGCTGTGGCTGGCAGCTGCAG
GCGTCCTGGGTGCGCCCGGGGGTCTTGTGGGACGTGGCGCTGGTCGCCGTGGCCGCGCTG
GGCCTGGCTCTTCTGGCTGGCCTGCTGTGTGCCACCACAGAGGCCCTGGATTGA
GenBank Gene IDX52997
GeneCard IDNot Available
GenAtlas IDGP9
HGNC IDHGNC:4444
Chromosome Location3
Locus3q21
References
  1. Hickey MJ, Deaven LL, Roth GJ: Human platelet glycoprotein IX. Characterization of cDNA and localization of the gene to chromosome 3. FEBS Lett. 1990 Nov 12;274(1-2):189-92. 2253772
  2. Hickey MJ, Roth GJ: Characterization of the gene encoding human platelet glycoprotein IX. J Biol Chem. 1993 Feb 15;268(5):3438-43. 8429020
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Hickey MJ, Williams SA, Roth GJ: Human platelet glycoprotein IX: an adhesive prototype of leucine-rich glycoproteins with flank-center-flank structures. Proc Natl Acad Sci U S A. 1989 Sep;86(17):6773-7. 2771955
  5. Hayashi T, Suzuki K, Yahagi A, Akiba J, Tajima K, Satoh S, Sasaki H: Corrected DNA sequence of the platelet glycoprotein IX gene. Thromb Haemost. 1997 May;77(5):1034-5. 9184424
  6. Roth GJ, Ozols J, Nugent DJ, Williams SA: Isolation and characterization of human platelet glycoprotein IX. Biochem Biophys Res Commun. 1988 Oct 31;156(2):931-9. 3056407
  7. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. 12665801
  8. Wright SD, Michaelides K, Johnson DJ, West NC, Tuddenham EG: Double heterozygosity for mutations in the platelet glycoprotein IX gene in three siblings with Bernard-Soulier syndrome. Blood. 1993 May 1;81(9):2339-47. 8481514
  9. Noris P, Simsek S, Stibbe J, von dem Borne AE: A phenylalanine-55 to serine amino-acid substitution in the human glycoprotein IX leucine-rich repeat is associated with Bernard-Soulier syndrome. Br J Haematol. 1997 May;97(2):312-20. 9163595
  10. Noris P, Arbustini E, Spedini P, Belletti S, Balduini CL: A new variant of Bernard-Soulier syndrome characterized by dysfunctional glycoprotein (GP) Ib and severely reduced amounts of GPIX and GPV. Br J Haematol. 1998 Dec;103(4):1004-13. 9886312
  11. Kunishima S, Tomiyama Y, Honda S, Kurata Y, Kamiya T, Ozawa K, Saito H: Cys97-->Tyr mutation in the glycoprotein IX gene associated with Bernard-Soulier syndrome. Br J Haematol. 1999 Dec;107(3):539-45. 10583255
  12. Rivera CE, Villagra J, Riordan M, Williams S, Lindstrom KJ, Rick ME: Identification of a new mutation in platelet glycoprotein IX (GPIX) in a patient with Bernard-Soulier syndrome. Br J Haematol. 2001 Jan;112(1):105-8. 11167791
  13. Wang Z, Shi J, Han Y: [A novel point mutation in the transmembrane domain of platelet glycoprotein IX gene identified in a Bernard-Soulier syndrome patient]. Zhonghua Xue Ye Xue Za Zhi. 2001 Sep;22(9):464-6. 11758225
  14. Lanza F, De La Salle C, Baas MJ, Schwartz A, Boval B, Cazenave JP, Caen JP: A Leu7Pro mutation in the signal peptide of platelet glycoprotein (GP)IX in a case of Bernard-Soulier syndrome abolishes surface expression of the GPIb-V-IX complex. Br J Haematol. 2002 Jul;118(1):260-6. 12100158