ADP/ATP translocase 3

NameADP/ATP translocase 3
Synonyms
  • Adenine nucleotide translocator 3
  • ADP,ATP carrier protein 3
  • ADP,ATP carrier protein, isoform T2
  • ANT 2
  • ANT 3
  • ANT3
  • Solute carrier family 25 member 6
Gene NameSLC25A6
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010434|ADP/ATP translocase 3
MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI
Number of residues298
Molecular Weight32866.025
Theoretical pI10.26
GO Classification
Functions
  • ATP
Processes
  • modulation by virus of host morphology or physiology
  • active induction of host immune response by virus
  • ADP transport
  • ATP transport
  • protein targeting to mitochondrion
  • viral life cycle
  • small molecule metabolic process
  • cellular protein metabolic process
  • apoptotic process
  • energy reserve metabolic process
  • regulation of insulin secretion
  • viral process
Components
  • mitochondrial inner membrane presequence translocase complex
  • mitochondrion
  • nucleus
  • mitochondrial inner membrane
  • integral component of membrane
General FunctionAtp:adp antiporter activity
Specific FunctionCatalyzes the exchange of cytoplasmic ADP with mitochondrial ATP across the mitochondrial inner membrane. May participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis.
Pfam Domain Function
Transmembrane Regions5-39 75-100 109-143 176-202 207-241 273-298
GenBank Protein ID339723
UniProtKB IDP12236
UniProtKB Entry NameADT3_HUMAN
Cellular LocationMitochondrion inner membrane
Gene sequence
>lcl|BSEQ0010435|ADP/ATP translocase 3 (SLC25A6)
ATGACGGAACAGGCCATCTCCTTCGCCAAAGACTTCTTGGCCGGAGGCATCGCCGCCGCC
ATCTCCAAGACGGCCGTGGCTCCGATCGAGCGGGTCAAGCTGCTGCTGCAGGTCCAGCAC
GCCAGCAAGCAGATCGCCGCCGACAAGCAGTACAAGGGCATCGTGGACTGCATTGTCCGC
ATCCCCAAGGAGCAGGGCGTGCTGTCCTTCTGGAGGGGCAACCTTGCCAACGTCATTCGC
TACTTCCCCACTCAAGCCCTCAACTTCGCCTTCAAGGATAAGTACAAGCAGATCTTCCTG
GGGGGCGTGGACAAGCACACGCAGTTCTGGAGGTACTTTGCGGGCAACCTGGCCTCCGGC
GGTGCGGCCGGCGCGACCTCCCTCTGCTTCGTGTACCCGCTGGATTTCGCCAGAACCCGC
CTGGCAGCGGACGTGGGAAAGTCAGGCACAGAGCGCGAGTTCCGAGGCCTGGGAGACTGC
CTGGTGAAGATCACCAAGTCCGACGGCATCCGGGGCCTGTACCAGGGCTTCAGTGTCTCC
GTGCAGGGCATCATCATCTACCGGGCGGCCTACTTCGGCGTGTACGATACGGCCAAGGGC
ATGCTCCCCGACCCCAAGAACACGCACATCGTGGTGAGCTGGATGATCGCGCAGACCGTG
ACGGCCGTGGCCGGCGTGGTGTCCTACCCCTTCGACACGGTGCGGCGGCGCATGATGATG
CAGTCCGGGCGCAAAGGAGCTGACATCATGTACACGGGCACCGTCGACTGTTGGAGGAAG
ATCTTCAGAGATGAGGGGGGCAAGGCCTTCTTCAAGGGTGCGTGGTCCAACGTCCTGCGG
GGCATGGGGGGCGCCTTCGTGCTGGTCCTGTACGACGAGCTCAAGAAGGTGATCTAA
GenBank Gene IDJ03592
GeneCard IDNot Available
GenAtlas IDSLC25A6
HGNC IDHGNC:10992
Chromosome LocationX, Y
LocusXp22.32 and Yp11.3
References
  1. Cozens AL, Runswick MJ, Walker JE: DNA sequences of two expressed nuclear genes for human mitochondrial ADP/ATP translocase. J Mol Biol. 1989 Mar 20;206(2):261-80. 2541251
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Houldsworth J, Attardi G: Two distinct genes for ADP/ATP translocase are expressed at the mRNA level in adult human liver. Proc Natl Acad Sci U S A. 1988 Jan;85(2):377-81. 2829183
  4. Verrier F, Mignotte B, Jan G, Brenner C: Study of PTPC composition during apoptosis for identification of viral protein target. Ann N Y Acad Sci. 2003 Dec;1010:126-42. 15033708
  5. Deniaud A, Brenner C, Kroemer G: Mitochondrial membrane permeabilization by HIV-1 Vpr. Mitochondrion. 2004 Jul;4(2-3):223-33. 16120388
  6. Zamarin D, Garcia-Sastre A, Xiao X, Wang R, Palese P: Influenza virus PB1-F2 protein induces cell death through mitochondrial ANT3 and VDAC1. PLoS Pathog. 2005 Sep;1(1):e4. Epub 2005 Sep 30. 16201016
  7. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. 18691976
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  9. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  10. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  11. Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C: Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-alpha-acetylation features. Mol Cell Proteomics. 2012 Jun;11(6):M111.015131. doi: 10.1074/mcp.M111.015131. Epub 2012 Jan 5. 22223895
  12. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712