NameFibroblast growth factor 4
Synonyms
  • FGF-4
  • HBGF-4
  • Heparin secretory-transforming protein 1
  • Heparin-binding growth factor 4
  • HST
  • HST-1
  • HSTF-1
  • HSTF1
  • KS3
  • Transforming protein KS3
Gene NameFGF4
OrganismHuman
Amino acid sequence
>lcl|BSEQ0000649|Fibroblast growth factor 4
MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPV
AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP
VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIA
LSKNGKTKKGNRVSPTMKVTHFLPRL
Number of residues206
Molecular Weight22047.355
Theoretical pI10.19
GO Classification
Functions
  • growth factor activity
  • heparin binding
Processes
  • apoptotic process involved in morphogenesis
  • innate immune response
  • cartilage condensation
  • Fc-epsilon receptor signaling pathway
  • chondroblast differentiation
  • activation of MAPKK activity
  • cranial suture morphogenesis
  • fibroblast growth factor receptor signaling pathway
  • embryonic hindlimb morphogenesis
  • insulin receptor signaling pathway
  • mesenchymal cell proliferation
  • MAPK cascade
  • positive regulation of cell division
  • negative regulation of apoptotic process
  • regulation of endothelial cell chemotaxis to fibroblast growth factor
  • neurotrophin TRK receptor signaling pathway
  • stem cell population maintenance
  • positive regulation of transcription from RNA polymerase II promoter
  • signal transduction
  • Ras protein signal transduction
  • vascular endothelial growth factor receptor signaling pathway
  • positive regulation of cell proliferation
  • small GTPase mediated signal transduction
  • odontogenesis of dentin-containing tooth
  • cell-cell signaling
  • phosphatidylinositol-mediated signaling
  • axon guidance
  • positive regulation of ERK1 and ERK2 cascade
  • epidermal growth factor receptor signaling pathway
Components
  • intracellular
  • extracellular region
General FunctionHeparin binding
Specific FunctionPlays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID386788
UniProtKB IDP08620
UniProtKB Entry NameFGF4_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0018940|Fibroblast growth factor 4 (FGF4)
ATGTCGGGGCCCGGGACGGCCGCGGTAGCGCTGCTCCCGGCGGTCCTGCTGGCCTTGCTG
GCGCCCTGGGCGGGCCGAGGGGGCGCCGCCGCACCCACTGCACCCAACGGCACGCTGGAG
GCCGAGCTGGAGCGCCGCTGGGAGAGCCTGGTGGCGCTCTCGTTGGCGCGCCTGCCGGTG
GCAGCGCAGCCCAAGGAGGCGGCCGTCCAGAGCGGCGCCGGCGACTACCTGCTGGGCATC
AAGCGGCTGCGGCGGCTCTACTGCAACGTGGGCATCGGCTTCCACCTCCAGGCGCTCCCC
GACGGCCGCATCGGCGGCGCGCACGCGGACACCCGCGACAGCCTGCTGGAGCTCTCGCCC
GTGGAGCGGGGCGTGGTGAGCATCTTCGGCGTGGCCAGCCGGTTCTTCGTGGCCATGAGC
AGCAAGGGCAAGCTCTATGGCTCGCCCTTCTTCACCGATGAGTGCACGTTCAAGGAGATT
CTCCTTCCCAACAACTACAACGCCTACGAGTCCTACAAGTACCCCGGCATGTTCATCGCC
CTGAGCAAGAATGGGAAGACCAAGAAGGGGAACCGAGTGTCGCCCACCATGAAGGTCACC
CACTTCCTCCCCAGGCTGTGA
GenBank Gene IDJ02986
GeneCard IDNot Available
GenAtlas IDFGF4
HGNC IDHGNC:3682
Chromosome Location11
Locus11q13.3
References
  1. Mayshar Y, Rom E, Chumakov I, Kronman A, Yayon A, Benvenisty N: Fibroblast growth factor 4 and its novel splice isoform have opposing effects on the maintenance of human embryonic stem cell self-renewal. Stem Cells. 2008 Mar;26(3):767-74. doi: 10.1634/stemcells.2007-1037. Epub 2008 Jan 10. 18192227
  2. Yoshida T, Miyagawa K, Odagiri H, Sakamoto H, Little PF, Terada M, Sugimura T: Genomic sequence of hst, a transforming gene encoding a protein homologous to fibroblast growth factors and the int-2-encoded protein. Proc Natl Acad Sci U S A. 1987 Oct;84(20):7305-9. 2959959
  3. Taira M, Yoshida T, Miyagawa K, Sakamoto H, Terada M, Sugimura T: cDNA sequence of human transforming gene hst and identification of the coding sequence required for transforming activity. Proc Natl Acad Sci U S A. 1987 May;84(9):2980-4. 2953031
  4. Delli Bovi P, Curatola AM, Kern FG, Greco A, Ittmann M, Basilico C: An oncogene isolated by transfection of Kaposi's sarcoma DNA encodes a growth factor that is a member of the FGF family. Cell. 1987 Aug 28;50(5):729-37. 2957062
  5. Ornitz DM, Xu J, Colvin JS, McEwen DG, MacArthur CA, Coulier F, Gao G, Goldfarb M: Receptor specificity of the fibroblast growth factor family. J Biol Chem. 1996 Jun 21;271(25):15292-7. 8663044
  6. Turner N, Grose R: Fibroblast growth factor signalling: from development to cancer. Nat Rev Cancer. 2010 Feb;10(2):116-29. doi: 10.1038/nrc2780. 20094046
  7. Bellosta P, Iwahori A, Plotnikov AN, Eliseenkova AV, Basilico C, Mohammadi M: Identification of receptor and heparin binding sites in fibroblast growth factor 4 by structure-based mutagenesis. Mol Cell Biol. 2001 Sep;21(17):5946-57. 11486033