Complement decay-accelerating factor

NameComplement decay-accelerating factor
Synonyms
  • CR
  • DAF
Gene NameCD55
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001850|Complement decay-accelerating factor
MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTV
ITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFP
VGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGI
LFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGER
DHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPT
TVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLS
GHTCFTLTGLLGTLVTMGLLT
Number of residues381
Molecular Weight41399.79
Theoretical pI7.64
GO Classification
Functions
  • virus receptor activity
  • lipid binding
Processes
  • positive regulation of CD4-positive, alpha-beta T cell activation
  • positive regulation of CD4-positive, alpha-beta T cell proliferation
  • regulation of complement activation
  • regulation of lipopolysaccharide-mediated signaling pathway
  • negative regulation of complement activation
  • innate immune response
  • positive regulation of cytosolic calcium ion concentration
  • viral entry into host cell
  • respiratory burst
  • complement activation, classical pathway
  • CD4-positive, alpha-beta T cell cytokine production
Components
  • plasma membrane
  • cell surface
  • cytosol
  • extracellular exosome
  • integral component of plasma membrane
  • membrane raft
  • anchored component of membrane
  • extracellular region
General FunctionVirus receptor activity
Specific FunctionThis protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade.(Microbial infection) Acts as a receptor for coxsackievirus A21, coxsackieviruses B1, B3 and B5 (PubMed:9151867). Acts as a receptor for human enterovirus 70 and D68 (Probable) (PubMed:8764022). Acts as a receptor for human echoviruses 6, 7, 11, 12, 20 and 21 (PubMed:7525274).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID181468
UniProtKB IDP08174
UniProtKB Entry NameDAF_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0019031|Complement decay-accelerating factor (CD55)
ATGACCGTCGCGCGGCCGAGCGTGCCCGCGGCGCTGCCCCTCCTCGGGGAGCTGCCCCGG
CTGCTGCTGCTGGTGCTGTTGTGCCTGCCGGCCGTGTGGGGTGACTGTGGCCTTCCCCCA
GATGTACCTAATGCCCAGCCAGCTTTGGAAGGCCGTACAAGTTTTCCCGAGGATACTGTA
ATAACGTACAAATGTGAAGAAAGCTTTGTGAAAATTCCTGGCGAGAAGGACTCAGTGATC
TGCCTTAAGGGCAGTCAATGGTCAGATATTGAAGAGTTCTGCAATCGTAGCTGCGAGGTG
CCAACAAGGCTAAATTCTGCATCCCTCAAACAGCCTTATATCACTCAGAATTATTTTCCA
GTCGGTACTGTTGTGGAATATGAGTGCCGTCCAGGTTACAGAAGAGAACCTTCTCTATCA
CCAAAACTAACTTGCCTTCAGAATTTAAAATGGTCCACAGCAGTCGAATTTTGTAAAAAG
AAATCATGCCCTAATCCGGGAGAAATACGAAATGGTCAGATTGATGTACCAGGTGGCATA
TTATTTGGTGCAACCATCTCCTTCTCATGTAACACAGGGTACAAATTATTTGGCTCGACT
TCTAGTTTTTGTCTTATTTCAGGCAGCTCTGTCCAGTGGAGTGACCCGTTGCCAGAGTGC
AGAGAAATTTATTGTCCAGCACCACCACAAATTGACAATGGAATAATTCAAGGGGAACGT
GACCATTATGGATATAGACAGTCTGTAACGTATGCATGTAATAAAGGATTCACCATGATT
GGAGAGCACTCTATTTATTGTACTGTGAATAATGATGAAGGAGAGTGGAGTGGCCCACCA
CCTGAATGCAGAGGAAAATCTCTAACTTCCAAGGTCCCACCAACAGTTCAGAAACCTACC
ACAGTAAATGTTCCAACTACAGAAGTCTCACCAACTTCTCAGAAAACCACCACAAAAACC
ACCACACCAAATGCTCAAGCAACACGGAGTACACCTGTTTCCAGGACAACCAAGCATTTT
CATGAAACAACCCCAAATAAAGGAAGTGGAACCACTTCAGGTACTACCCGTCTTCTATCT
GGGCACACGTGTTTCACGTTGACAGGTTTGCTTGGGACGCTAGTAACCATGGGCTTGCTG
ACTTAG
GenBank Gene IDM31516
GeneCard IDNot Available
GenAtlas IDCD55
HGNC IDHGNC:2665
Chromosome Location1
Locus1q32
References
  1. Caras IW, Davitz MA, Rhee L, Weddell G, Martin DW Jr, Nussenzweig V: Cloning of decay-accelerating factor suggests novel use of splicing to generate two proteins. Nature. 1987 Feb 5-11;325(6104):545-9. 2433596
  2. Osuka F, Endo Y, Higuchi M, Suzuki H, Shio Y, Fujiu K, Kanno R, Oishi A, Terashima M, Fujita T, Gotoh M: Molecular cloning and characterization of novel splicing variants of human decay-accelerating factor. Genomics. 2006 Sep;88(3):316-22. Epub 2006 Feb 28. 16503113
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Ewulonu UK, Ravi L, Medof ME: Characterization of the decay-accelerating factor gene promoter region. Proc Natl Acad Sci U S A. 1991 Jun 1;88(11):4675-9. 1711208
  6. Medof ME, Lublin DM, Holers VM, Ayers DJ, Getty RR, Leykam JF, Atkinson JP, Tykocinski ML: Cloning and characterization of cDNAs encoding the complete sequence of decay-accelerating factor of human complement. Proc Natl Acad Sci U S A. 1987 Apr;84(7):2007-11. 2436222
  7. Sugita Y, Negoro T, Matsuda T, Sakamoto T, Tomita M: Improved method for the isolation and preliminary characterization of human DAF (decay-accelerating factor). J Biochem. 1986 Jul;100(1):143-50. 2428813
  8. Nakano Y, Sugita Y, Ishikawa Y, Choi NH, Tobe T, Tomita M: Isolation of two forms of decay-accelerating factor (DAF) from human urine. Biochim Biophys Acta. 1991 Jul 8;1074(2):326-30. 1712233
  9. Moran P, Raab H, Kohr WJ, Caras IW: Glycophospholipid membrane anchor attachment. Molecular analysis of the cleavage/attachment site. J Biol Chem. 1991 Jan 15;266(2):1250-7. 1824699
  10. Nakano Y, Sumida K, Kikuta N, Miura NH, Tobe T, Tomita M: Complete determination of disulfide bonds localized within the short consensus repeat units of decay accelerating factor (CD55 antigen). Biochim Biophys Acta. 1992 Jun 12;1116(3):235-40. 1377029
  11. Ward T, Pipkin PA, Clarkson NA, Stone DM, Minor PD, Almond JW: Decay-accelerating factor CD55 is identified as the receptor for echovirus 7 using CELICS, a rapid immuno-focal cloning method. EMBO J. 1994 Nov 1;13(21):5070-4. 7525274
  12. Bergelson JM, Chan M, Solomon KR, St John NF, Lin H, Finberg RW: Decay-accelerating factor (CD55), a glycosylphosphatidylinositol-anchored complement regulatory protein, is a receptor for several echoviruses. Proc Natl Acad Sci U S A. 1994 Jun 21;91(13):6245-8. 7517044
  13. Shafren DR, Bates RC, Agrez MV, Herd RL, Burns GF, Barry RD: Coxsackieviruses B1, B3, and B5 use decay accelerating factor as a receptor for cell attachment. J Virol. 1995 Jun;69(6):3873-7. 7538177
  14. Karnauchow TM, Tolson DL, Harrison BA, Altman E, Lublin DM, Dimock K: The HeLa cell receptor for enterovirus 70 is decay-accelerating factor (CD55). J Virol. 1996 Aug;70(8):5143-52. 8764022
  15. Shafren DR, Dorahy DJ, Ingham RA, Burns GF, Barry RD: Coxsackievirus A21 binds to decay-accelerating factor but requires intercellular adhesion molecule 1 for cell entry. J Virol. 1997 Jun;71(6):4736-43. 9151867
  16. Blomqvist S, Savolainen C, Raman L, Roivainen M, Hovi T: Human rhinovirus 87 and enterovirus 68 represent a unique serotype with rhinovirus and enterovirus features. J Clin Microbiol. 2002 Nov;40(11):4218-23. 12409401
  17. Elortza F, Nuhse TS, Foster LJ, Stensballe A, Peck SC, Jensen ON: Proteomic analysis of glycosylphosphatidylinositol-anchored membrane proteins. Mol Cell Proteomics. 2003 Dec;2(12):1261-70. Epub 2003 Sep 29. 14517339
  18. Elortza F, Mohammed S, Bunkenborg J, Foster LJ, Nuhse TS, Brodbeck U, Peck SC, Jensen ON: Modification-specific proteomics of plasma membrane proteins: identification and characterization of glycosylphosphatidylinositol-anchored proteins released upon phospholipase D treatment. J Proteome Res. 2006 Apr;5(4):935-43. 16602701
  19. Hafenstein S, Bowman VD, Chipman PR, Bator Kelly CM, Lin F, Medof ME, Rossmann MG: Interaction of decay-accelerating factor with coxsackievirus B3. J Virol. 2007 Dec;81(23):12927-35. Epub 2007 Sep 5. 17804498
  20. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. 19159218
  21. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  22. Mizuhashi K, Chaya T, Kanamoto T, Omori Y, Furukawa T: Obif, a Transmembrane Protein, Is Required for Bone Mineralization and Spermatogenesis in Mice. PLoS One. 2015 Jul 24;10(7):e0133704. doi: 10.1371/journal.pone.0133704. eCollection 2015. 26207632
  23. Lublin DM, Mallinson G, Poole J, Reid ME, Thompson ES, Ferdman BR, Telen MJ, Anstee DJ, Tanner MJ: Molecular basis of reduced or absent expression of decay-accelerating factor in Cromer blood group phenotypes. Blood. 1994 Aug 15;84(4):1276-82. 7519480
  24. Storry JR, Sausais L, Hue-Roye K, Mudiwa F, Ferrer Z, Blajchman MA, Lublin DM, Ma BW, Miquel JF, Nervi F, Pereira J, Reid ME: GUTI: a new antigen in the Cromer blood group system. Transfusion. 2003 Mar;43(3):340-4. 12675719
  25. Reid ME, Mallinson G, Sim RB, Poole J, Pausch V, Merry AH, Liew YW, Tanner MJ: Biochemical studies on red blood cells from a patient with the Inab phenotype (decay-accelerating factor deficiency). Blood. 1991 Dec 15;78(12):3291-7. 1720702
  26. Williams P, Chaudhry Y, Goodfellow IG, Billington J, Powell R, Spiller OB, Evans DJ, Lea S: Mapping CD55 function. The structure of two pathogen-binding domains at 1.7 A. J Biol Chem. 2003 Mar 21;278(12):10691-6. Epub 2002 Dec 22. 12499389
  27. Lukacik P, Roversi P, White J, Esser D, Smith GP, Billington J, Williams PA, Rudd PM, Wormald MR, Harvey DJ, Crispin MD, Radcliffe CM, Dwek RA, Evans DJ, Morgan BP, Smith RA, Lea SM: Complement regulation at the molecular level: the structure of decay-accelerating factor. Proc Natl Acad Sci U S A. 2004 Feb 3;101(5):1279-84. Epub 2004 Jan 20. 14734808
  28. Uhrinova S, Lin F, Ball G, Bromek K, Uhrin D, Medof ME, Barlow PN: Solution structure of a functionally active fragment of decay-accelerating factor. Proc Natl Acad Sci U S A. 2003 Apr 15;100(8):4718-23. Epub 2003 Apr 2. 12672958