| Name | Trypsin-2 |
|---|
| Synonyms | - 3.4.21.4
- Anionic trypsinogen
- Serine protease 2
- TRY2
- TRYP2
- Trypsin II
|
|---|
| Gene Name | PRSS2 |
|---|
| Organism | Human |
|---|
| Amino acid sequence | >lcl|BSEQ0017464|Trypsin-2
MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVIN
SRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKIT
NNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIK
DTIAANS |
|---|
| Number of residues | 247 |
|---|
| Molecular Weight | 26487.55 |
|---|
| Theoretical pI | Not Available |
|---|
| GO Classification | Functions - calcium ion binding
- serine-type endopeptidase activity
Processes - proteolysis
- digestion
- innate immune response
- collagen catabolic process
- extracellular matrix disassembly
- extracellular matrix organization
- positive regulation of cell growth
- positive regulation of cell adhesion
Components - extracellular matrix
- extracellular region
- extracellular space
|
|---|
| General Function | Serine-type endopeptidase activity |
|---|
| Specific Function | In the ileum, may be involved in defensin processing, including DEFA5. |
|---|
| Pfam Domain Function | |
|---|
| Transmembrane Regions | Not Available |
|---|
| GenBank Protein ID | Not Available |
|---|
| UniProtKB ID | P07478 |
|---|
| UniProtKB Entry Name | TRY2_HUMAN |
|---|
| Cellular Location | Secreted |
|---|
| Gene sequence | Not Available |
|---|
| GenBank Gene ID | Not Available |
|---|
| GeneCard ID | Not Available |
|---|
| GenAtlas ID | Not Available |
|---|
| HGNC ID | HGNC:9483 |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | Not Available |
|---|
| References | - Emi M, Nakamura Y, Ogawa M, Yamamoto T, Nishide T, Mori T, Matsubara K: Cloning, characterization and nucleotide sequences of two cDNAs encoding human pancreatic trypsinogens. Gene. 1986;41(2-3):305-10. 3011602
- Kimland M, Russick C, Marks WH, Borgstrom A: Immunoreactive anionic and cationic trypsin in human serum. Clin Chim Acta. 1989 Sep 15;184(1):31-46. 2598466
- Ghosh D, Porter E, Shen B, Lee SK, Wilk D, Drazba J, Yadav SP, Crabb JW, Ganz T, Bevins CL: Paneth cell trypsin is the processing enzyme for human defensin-5. Nat Immunol. 2002 Jun;3(6):583-90. Epub 2002 May 20. 12021776
- Sahin-Toth M, Kukor Z, Nemoda Z: Human cationic trypsinogen is sulfated on Tyr154. FEBS J. 2006 Nov;273(22):5044-50. 17087724
- Szabo A, Salameh MA, Ludwig M, Radisky ES, Sahin-Toth M: Tyrosine sulfation of human trypsin steers S2' subsite selectivity towards basic amino acids. PLoS One. 2014 Jul 10;9(7):e102063. doi: 10.1371/journal.pone.0102063. eCollection 2014. 25010489
- Ronai Z, Witt H, Rickards O, Destro-Bisol G, Bradbury AR, Sahin-Toth M: A common African polymorphism abolishes tyrosine sulfation of human anionic trypsinogen (PRSS2). Biochem J. 2009 Feb 15;418(1):155-61. doi: 10.1042/BJ20081848. 18986305
|
|---|
