NameComplement component C8 gamma chain
Synonyms
  • Complement component C8 gamma chain precursor
Gene NameC8G
OrganismHuman
Amino acid sequence
>lcl|BSEQ0019397|Complement component C8 gamma chain
MLPPGTATLLTLLLAAGSLGQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSAC
RFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDAR
GAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIF
YFPKYGFCEAADQFHVLDEVRR
Number of residues202
Molecular Weight22277.285
Theoretical pI8.48
GO Classification
Functions
  • retinol binding
Processes
  • innate immune response
  • cytolysis
  • complement activation, classical pathway
  • complement activation, alternative pathway
  • regulation of complement activation
Components
  • blood microparticle
  • membrane attack complex
  • extracellular region
  • extracellular exosome
General FunctionRetinol binding
Specific FunctionC8 is a constituent of the membrane attack complex. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit seems to be able to bind retinol.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP07360
UniProtKB Entry NameCO8G_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0019398|Complement component C8 gamma chain (C8G)
ATGCTGCCCCCTGGGACTGCGACCCTCTTGACTCTGCTCCTGGCAGCTGGCTCGCTGGGC
CAGAAGCCTCAGAGGCCACGCCGGCCCGCATCCCCCATCAGCACCATCCAGCCCAAGGCC
AATTTTGATGCTCAGCAGTTTGCAGGGACCTGGCTCCTTGTGGCTGTGGGCTCCGCTTGC
CGTTTCCTGCAGGAGCAGGGCCACCGGGCCGAGGCCACCACACTGCATGTGGCTCCCCAG
GGCACAGCCATGGCTGTCAGTACCTTCCGAAAGCTGGATGGGATCTGCTGGCAGGTGCGC
CAGCTCTATGGAGACACAGGGGTCCTCGGCCGCTTCCTGCTTCAAGCCCGAGACGCCCGA
GGGGCTGTGCACGTGGTTGTCGCTGAGACCGACTACCAGAGTTTCGCTGTCCTGTACCTG
GAGCGGGCGGGGCAGCTGTCAGTGAAGCTCTACGCCCGCTCGCTCCCTGTGAGCGACTCG
GTCCTGAGTGGGTTTGAGCAGCGGGTCCAGGAGGCCCACCTGACTGAGGACCAGATCTTC
TACTTCCCCAAGTACGGCTTCTGCGAGGCTGCAGACCAGTTCCACGTCCTGGACGAAGTG
AGGAGGTGA
GenBank Gene IDM17263
GeneCard IDNot Available
GenAtlas IDC8G
HGNC IDHGNC:1354
Chromosome Location9
Locus9q34.3
References
  1. Ng SC, Rao AG, Howard OM, Sodetz JM: The eighth component of human complement: evidence that it is an oligomeric serum protein assembled from products of three different genes. Biochemistry. 1987 Aug 25;26(17):5229-33. 3676249
  2. Haefliger JA, Jenne D, Stanley KK, Tschopp J: Structural homology of human complement component C8 gamma and plasma protein HC: identity of the cysteine bond pattern. Biochem Biophys Res Commun. 1987 Dec 16;149(2):750-4. 2447883
  3. Kaufman KM, Sodetz JM: Genomic structure of the human complement protein C8 gamma: homology to the lipocalin gene family. Biochemistry. 1994 May 3;33(17):5162-6. 8172891
  4. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. 15164053
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Hunt LT, Elzanowski A, Barker WC: The homology of complement factor C8 gamma chain and alpha-1-microglobulin. Biochem Biophys Res Commun. 1987 Nov 30;149(1):282-8. 2446620
  7. Haefliger JA, Peitsch MC, Jenne DE, Tschopp J: Structural and functional characterization of complement C8 gamma, a member of the lipocalin protein family. Mol Immunol. 1991 Jan-Feb;28(1-2):123-31. 1707134
  8. Schreck SF, Parker C, Plumb ME, Sodetz JM: Human complement protein C8 gamma. Biochim Biophys Acta. 2000 Oct 18;1482(1-2):199-208. 11058761
  9. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  10. Ortlund E, Parker CL, Schreck SF, Ginell S, Minor W, Sodetz JM, Lebioda L: Crystal structure of human complement protein C8gamma at 1.2 A resolution reveals a lipocalin fold and a distinct ligand binding site. Biochemistry. 2002 Jun 4;41(22):7030-7. 12033936
  11. Chiswell B, Lovelace LL, Brannen C, Ortlund EA, Lebioda L, Sodetz JM: Structural features of the ligand binding site on human complement protein C8gamma: a member of the lipocalin family. Biochim Biophys Acta. 2007 May;1774(5):637-44. Epub 2007 Mar 20. 17452033
  12. Lovelace LL, Chiswell B, Slade DJ, Sodetz JM, Lebioda L: Crystal structure of complement protein C8gamma in complex with a peptide containing the C8gamma binding site on C8alpha: implications for C8gamma ligand binding. Mol Immunol. 2008 Feb;45(3):750-6. Epub 2007 Aug 9. 17692377