Ig kappa chain V-IV region Len

NameIg kappa chain V-IV region Len
SynonymsNot Available
Gene NameNot Available
OrganismHuman
Amino acid sequence
>lcl|BSEQ0011922|Ig kappa chain V-IV region Len
DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNSKNYLAWYQQKPGQPPKLLIYWASTR
ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPYSFGQGTKLEIKR
Number of residues114
Molecular Weight12639.965
Theoretical pI8.15
GO Classification
Functions
  • antigen binding
Processes
  • complement activation
  • Fc-gamma receptor signaling pathway involved in phagocytosis
  • innate immune response
  • Fc-epsilon receptor signaling pathway
  • receptor-mediated endocytosis
  • regulation of immune response
  • complement activation, classical pathway
  • immune response
Components
  • plasma membrane
  • blood microparticle
  • extracellular region
General FunctionAntigen binding
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP06312
UniProtKB Entry NameKV402_HUMAN
Cellular LocationNot Available
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDNot Available
Chromosome LocationNot Available
LocusNot Available
References
  1. Schneider M, Hilschmann N: [The primary structure of a monoclonic immunoglobulin-L-chain of subgroup IV of the kappa type (Bence-Jones protein Len.)]. Hoppe Seylers Z Physiol Chem. 1975 May;356(5):507-57. 50995