NameIntegrin beta-3
Synonyms
  • GP3A
  • GPIIIa
  • Platelet membrane glycoprotein IIIa
Gene NameITGB3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0002297|Integrin beta-3
MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT
Number of residues788
Molecular Weight87056.975
Theoretical pI4.85
GO Classification
Functions
  • extracellular matrix binding
  • cell adhesion molecule binding
  • enzyme binding
  • virus receptor activity
  • vascular endothelial growth factor receptor 2 binding
  • platelet-derived growth factor receptor binding
  • fibronectin binding
  • protease binding
  • identical protein binding
  • protein disulfide isomerase activity
Processes
  • cell-substrate adhesion
  • extracellular matrix organization
  • cell-matrix adhesion
  • positive regulation of endothelial cell proliferation
  • leukocyte migration
  • activation of protein kinase activity
  • viral entry into host cell
  • vascular endothelial growth factor receptor signaling pathway
  • positive regulation of vascular endothelial growth factor receptor signaling pathway
  • negative chemotaxis
  • wound healing
  • protein folding
  • angiogenesis involved in wound healing
  • negative regulation of lipid storage
  • platelet degranulation
  • cell growth
  • negative regulation of lipid transport
  • integrin-mediated signaling pathway
  • negative regulation of lipoprotein metabolic process
  • platelet aggregation
  • platelet activation
  • negative regulation of low-density lipoprotein particle receptor biosynthetic process
  • apolipoprotein A-I-mediated signaling pathway
  • heterotypic cell-cell adhesion
  • cell-substrate junction assembly
  • negative regulation of macrophage derived foam cell differentiation
  • substrate adhesion-dependent cell spreading
  • positive regulation of endothelial cell migration
  • axon guidance
  • mesodermal cell differentiation
  • cell migration
  • regulation of bone resorption
  • tube development
  • cell adhesion
  • positive regulation of peptidyl-tyrosine phosphorylation
  • blood coagulation
  • positive regulation of protein phosphorylation
  • smooth muscle cell migration
Components
  • ruffle membrane
  • filopodium membrane
  • receptor complex
  • integrin alphav-beta3 complex
  • integrin complex
  • platelet alpha granule membrane
  • cell surface
  • extracellular exosome
  • alphav-beta3 integrin-vitronectin complex
  • focal adhesion
  • melanosome
  • microvillus membrane
  • nucleus
  • integral component of plasma membrane
  • plasma membrane
  • lamellipodium membrane
General FunctionVirus receptor activity
Specific FunctionIntegrin alpha-V/beta-3 (ITGAV:ITGB3) is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin alpha-IIb/beta-3 (ITGA2B:ITGB3) is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. Integrins alpha-IIb/beta-3 and alpha-V/beta-3 recognize the sequence R-G-D in a wide array of ligands. Integrin alpha-IIb/beta-3 recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. Fibrinogen binding enhances SELP expression in activated platelets (By similarity).(Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for herpes virus 8/HHV-8 (PubMed:18045938). Integrin ITGAV:ITGB3 acts as a receptor for coxsackievirus A9 (PubMed:7519807). Acts as a receptor for Hantaan virus (PubMed:9618541). Integrin ITGAV:ITGB3 acts as a receptor for cytomegalovirus/HHV-5 (PubMed:15834425). Integrin ITGA5:ITGB3 acts as a receptor for human metapneumovirus (PubMed:24478423). Integrin ITGAV:ITGB3 acts aP05556s a receptor for human parechovirus 1 (PubMed:11160695). Integrin ITGAV:ITGB3 acts as a receptor for west nile virus (PubMed:23658209). In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions (PubMed:10397733).
Pfam Domain Function
Transmembrane Regions719-741
GenBank Protein ID306786
UniProtKB IDP05106
UniProtKB Entry NameITB3_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0021847|Integrin beta-3 (ITGB3)
ATGCGAGCGCGGCCGCGGCCCCGGCCGCTCTGGGCGACTGTGCTGGCGCTGGGGGCGCTG
GCGGGCGTTGGCGTAGGAGGGCCCAACATCTGTACCACGCGAGGTGTGAGCTCCTGCCAG
CAGTGCCTGGCTGTGAGCCCCATGTGTGCCTGGTGCTCTGATGAGGCCCTGCCTCTGGGC
TCACCTCGCTGTGACCTGAAGGAGAATCTGCTGAAGGATAACTGTGCCCCAGAATCCATC
GAGTTCCCAGTGAGTGAGGCCCGAGTACTAGAGGACAGGCCCCTCAGCGACAAGGGCTCT
GGAGACAGCTCCCAGGTCACTCAAGTCAGTCCCCAGAGGATTGCACTCCGGCTCCGGCCA
GATGATTCGAAGAATTTCTCCATCCAAGTGCGGCAGGTGGAGGATTACCCTGTGGACATC
TACTACTTGATGGACCTGTCTTACTCCATGAAGGATGATCTGTGGAGCATCCAGAACCTG
GGTACCAAGCTGGCCACCCAGATGCGAAAGCTCACCAGTAACCTGCGGATTGGCTTCGGG
GCATTTGTGGACAAGCCTGTGTCACCATACATGTATATCTCCCCACCAGAGGCCCTCGAA
AACCCCTGCTATGATATGAAGACCACCTGCTTGCCCATGTTTGGCTACAAACACGTGCTG
ACGCTAACTGACCAGGTGACCCGCTTCAATGAGGAAGTGAAGAAGCAGAGTGTGTCACGG
AACCGAGATGCCCCAGAGGGTGGCTTTGATGCCATCATGCAGGCTACAGTCTGTGATGAA
AAGATTGGCTGGAGGAATGATGCATCCCACTTGCTGGTGTTTACCACTGATGCCAAGACT
CATATAGCATTGGACGGAAGGCTGGCAGGCATTGTCCAGCCTAATGACGGGCAGTGTCAT
GTTGGTAGTGACAATCATTACTCTGCCTCCACTACCATGGATTATCCCTCTTTGGGGCTG
ATGACTGAGAAGCTATCCCAGAAAAACATCAATTTGATCTTTGCAGTGACTGAAAATGTA
GTCAATCTCTATCAGAACTATAGTGAGCTCATCCCAGGGACCACAGTTGGGGTTCTGTCC
ATGGATTCCAGCAATGTCCTCCAGCTCATTGTTGATGCTTATGGGAAAATCCGTTCTAAA
GTAGAGCTGGAAGTGCGTGACCTCCCTGAAGAGTTGTCTCTATCCTTCAATGCCACCTGC
CTCAACAATGAGGTCATCCCTGGCCTCAAGTCTTGTATGGGACTCAAGATTGGAGACACG
GTGAGCTTCAGCATTGAGGCCAAGGTGCGAGGCTGTCCCCAGGAGAAGGAGAAGTCCTTT
ACCATAAAGCCCGTGGGCTTCAAGGACAGCCTGATCGTCCAGGTCACCTTTGATTGTGAC
TGTGCCTGCCAGGCCCAAGCTGAACCTAATAGCCATCGCTGCAACAATGGCAATGGGACC
TTTGAGTGTGGGGTATGCCGTTGTGGGCCTGGCTGGCTGGGATCCCAGTGTGAGTGCTCA
GAGGAGGACTATCGCCCTTCCCAGCAGGACGAATGCAGCCCCCGGGAGGGTCAGCCCGTC
TGCAGCCAGCGGGGCGAGTGCCTCTGTGGTCAATGTGTCTGCCACAGCAGTGACTTTGGC
AAGATCACGGGCAAGTACTGCGAGTGTGACGACTTCTCCTGTGTCCGCTACAAGGGGGAG
ATGTGCTCAGGCCATGGCCAGTGCAGCTGTGGGGACTGCCTGTGTGACTCCGACTGGACC
GGCTACTACTGCAACTGTACCACGCGTACTGACACCTGCATGTCCAGCAATGGGCTGCTG
TGCAGCGGCCGCGGCAAGTGTGAATGTGGCAGCTGTGTCTGTATCCAGCCGGGCTCCTAT
GGGGACACCTGTGAGAAGTGCCCCACCTGCCCAGATGCCTGCACCTTTAAGAAAGAATGT
GTGGAGTGTAAGAAGTTTGACCGGGGAGCCCTACATGACGAAAATACCTGCAACCGTTAC
TGCCGTGACGAGATTGAGTCAGTGAAAGAGCTTAAGGACACTGGCAAGGATGCAGTGAAT
TGTACCTATAAGAATGAGGATGACTGTGTCGTCAGATTCCAGTACTATGAAGATTCTAGT
GGAAAGTCCATCCTGTATGTGGTAGAAGAGCCAGAGTGTCCCAAGGGCCCTGACATCCTG
GTGGTCCTGCTCTCAGTGATGGGGGCCATTCTGCTCATTGGCCTTGCCGCCCTGCTCATC
TGGAAACTCCTCATCACCATCCACGACCGAAAAGAATTCGCTAAATTTGAGGAAGAACGC
GCCAGAGCAAAATGGGACACAGCCAACAACCCACTGTATAAAGAGGCCACGTCTACCTTC
ACCAATATCACGTACCGGGGCACTTAA
GenBank Gene IDJ02703
GeneCard IDNot Available
GenAtlas IDITGB3
HGNC IDHGNC:6156
Chromosome Location17
Locus17q21.32
References
  1. Fitzgerald LA, Steiner B, Rall SC Jr, Lo SS, Phillips DR: Protein sequence of endothelial glycoprotein IIIa derived from a cDNA clone. Identity with platelet glycoprotein IIIa and similarity to "integrin". J Biol Chem. 1987 Mar 25;262(9):3936-9. 3494014
  2. Zimrin AB, Eisman R, Vilaire G, Schwartz E, Bennett JS, Poncz M: Structure of platelet glycoprotein IIIa. A common subunit for two different membrane receptors. J Clin Invest. 1988 May;81(5):1470-5. 2452834
  3. Frachet P, Uzan G, Thevenon D, Denarier E, Prandini MH, Marguerie G: GPIIb and GPIIIa amino acid sequences deduced from human megakaryocyte cDNAs. Mol Biol Rep. 1990 Feb;14(1):27-33. 2345548
  4. Kumar CS, James IE, Wong A, Mwangi V, Feild JA, Nuthulaganti P, Connor JR, Eichman C, Ali F, Hwang SM, Rieman DJ, Drake FH, Gowen M: Cloning and characterization of a novel integrin beta3 subunit. J Biol Chem. 1997 Jun 27;272(26):16390-7. 9195946
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Villa-Garcia M, Li L, Riely G, Bray PF: Isolation and characterization of a TATA-less promoter for the human beta 3 integrin gene. Blood. 1994 Feb 1;83(3):668-76. 8298129
  7. Rosa JP, Bray PF, Gayet O, Johnston GI, Cook RG, Jackson KW, Shuman MA, McEver RP: Cloning of glycoprotein IIIa cDNA from human erythroleukemia cells and localization of the gene to chromosome 17. Blood. 1988 Aug;72(2):593-600. 3165296
  8. Catimel B, Parmentier S, Leung LL, McGregor JL: Separation of important new platelet glycoproteins (GPIa, GPIc, GPIc*, GPIIa and GMP-140) by f.p.l.c. Characterization by monoclonal antibodies and gas-phase sequencing. Biochem J. 1991 Oct 15;279 ( Pt 2):419-25. 1953640
  9. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. 12665801
  10. Zimrin AB, Gidwitz S, Lord S, Schwartz E, Bennett JS, White GC 2nd, Poncz M: The genomic organization of platelet glycoprotein IIIa. J Biol Chem. 1990 May 25;265(15):8590-5. 2341395
  11. Lanza F, Kieffer N, Phillips DR, Fitzgerald LA: Characterization of the human platelet glycoprotein IIIa gene. Comparison with the fibronectin receptor beta-subunit gene. J Biol Chem. 1990 Oct 25;265(30):18098-103. 2145280
  12. Jiang WM, Jenkins D, Yuan Q, Leung E, Choo KH, Watson JD, Krissansen GW: The gene organization of the human beta 7 subunit, the common beta subunit of the leukocyte integrins HML-1 and LPAM-1. Int Immunol. 1992 Sep;4(9):1031-40. 1382574
  13. Hiraiwa A, Matsukage A, Shiku H, Takahashi T, Naito K, Yamada K: Purification and partial amino acid sequence of human platelet membrane glycoproteins IIb and IIIa. Blood. 1987 Feb;69(2):560-4. 3801670
  14. van Kuppevelt TH, Languino LR, Gailit JO, Suzuki S, Ruoslahti E: An alternative cytoplasmic domain of the integrin beta 3 subunit. Proc Natl Acad Sci U S A. 1989 Jul;86(14):5415-8. 2787511
  15. Calvete JJ, Henschen A, Gonzalez-Rodriguez J: Assignment of disulphide bonds in human platelet GPIIIa. A disulphide pattern for the beta-subunits of the integrin family. Biochem J. 1991 Feb 15;274 ( Pt 1):63-71. 2001252
  16. Roivainen M, Piirainen L, Hovi T, Virtanen I, Riikonen T, Heino J, Hyypia T: Entry of coxsackievirus A9 into host cells: specific interactions with alpha v beta 3 integrin, the vitronectin receptor. Virology. 1994 Sep;203(2):357-65. 7519807
  17. Law DA, Nannizzi-Alaimo L, Phillips DR: Outside-in integrin signal transduction. Alpha IIb beta 3-(GP IIb IIIa) tyrosine phosphorylation induced by platelet aggregation. J Biol Chem. 1996 May 3;271(18):10811-5. 8631894
  18. Gavrilovskaya IN, Shepley M, Shaw R, Ginsberg MH, Mackow ER: beta3 Integrins mediate the cellular entry of hantaviruses that cause respiratory failure. Proc Natl Acad Sci U S A. 1998 Jun 9;95(12):7074-9. 9618541
  19. Barillari G, Sgadari C, Fiorelli V, Samaniego F, Colombini S, Manzari V, Modesti A, Nair BC, Cafaro A, Sturzl M, Ensoli B: The Tat protein of human immunodeficiency virus type-1 promotes vascular cell growth and locomotion by engaging the alpha5beta1 and alphavbeta3 integrins and by mobilizing sequestered basic fibroblast growth factor. Blood. 1999 Jul 15;94(2):663-72. 10397733
  20. Kirk RI, Sanderson MR, Lerea KM: Threonine phosphorylation of the beta 3 integrin cytoplasmic tail, at a site recognized by PDK1 and Akt/PKB in vitro, regulates Shc binding. J Biol Chem. 2000 Oct 6;275(40):30901-6. 10896934
  21. Joki-Korpela P, Marjomaki V, Krogerus C, Heino J, Hyypia T: Entry of human parechovirus 1. J Virol. 2001 Feb;75(4):1958-67. 11160695
  22. Obergfell A, Eto K, Mocsai A, Buensuceso C, Moores SL, Brugge JS, Lowell CA, Shattil SJ: Coordinate interactions of Csk, Src, and Syk kinases with [alpha]IIb[beta]3 initiate integrin signaling to the cytoskeleton. J Cell Biol. 2002 Apr 15;157(2):265-75. Epub 2002 Apr 8. 11940607
  23. van der Flier A, Kuikman I, Kramer D, Geerts D, Kreft M, Takafuta T, Shapiro SS, Sonnenberg A: Different splice variants of filamin-B affect myogenesis, subcellular distribution, and determine binding to integrin [beta] subunits. J Cell Biol. 2002 Jan 21;156(2):361-76. Epub 2002 Jan 21. 11807098
  24. Lin CG, Leu SJ, Chen N, Tebeau CM, Lin SX, Yeung CY, Lau LF: CCN3 (NOV) is a novel angiogenic regulator of the CCN protein family. J Biol Chem. 2003 Jun 27;278(26):24200-8. Epub 2003 Apr 13. 12695522
  25. Zhang H, Berg JS, Li Z, Wang Y, Lang P, Sousa AD, Bhaskar A, Cheney RE, Stromblad S: Myosin-X provides a motor-based link between integrins and the cytoskeleton. Nat Cell Biol. 2004 Jun;6(6):523-31. Epub 2004 May 23. 15156152
  26. Wang X, Huang DY, Huong SM, Huang ES: Integrin alphavbeta3 is a coreceptor for human cytomegalovirus. Nat Med. 2005 May;11(5):515-21. Epub 2005 Apr 17. 15834425
  27. Jordan PA, Stevens JM, Hubbard GP, Barrett NE, Sage T, Authi KS, Gibbins JM: A role for the thiol isomerase protein ERP5 in platelet function. Blood. 2005 Feb 15;105(4):1500-7. Epub 2004 Oct 5. 15466936
  28. Wadehra M, Forbes A, Pushkarna N, Goodglick L, Gordon LK, Williams CJ, Braun J: Epithelial membrane protein-2 regulates surface expression of alphavbeta3 integrin in the endometrium. Dev Biol. 2005 Nov 15;287(2):336-45. Epub 2005 Oct 10. 16216233
  29. Chen FH, Thomas AO, Hecht JT, Goldring MB, Lawler J: Cartilage oligomeric matrix protein/thrombospondin 5 supports chondrocyte attachment through interaction with integrins. J Biol Chem. 2005 Sep 23;280(38):32655-61. Epub 2005 Jul 28. 16051604
  30. Bennett JS: Structure and function of the platelet integrin alphaIIbbeta3. J Clin Invest. 2005 Dec;115(12):3363-9. 16322781
  31. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. 16335952
  32. Lewandrowski U, Moebius J, Walter U, Sickmann A: Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach. Mol Cell Proteomics. 2006 Feb;5(2):226-33. Epub 2005 Oct 31. 16263699
  33. Ma YQ, Qin J, Plow EF: Platelet integrin alpha(IIb)beta(3): activation mechanisms. J Thromb Haemost. 2007 Jul;5(7):1345-52. 17635696
  34. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. 18088087
  35. Garrigues HJ, Rubinchikova YE, Dipersio CM, Rose TM: Integrin alphaVbeta3 Binds to the RGD motif of glycoprotein B of Kaposi's sarcoma-associated herpesvirus and functions as an RGD-dependent entry receptor. J Virol. 2008 Feb;82(3):1570-80. Epub 2007 Nov 28. 18045938
  36. Anani Sarab G, Moss M, Barker RN, Urbaniak SJ: Naturally processed peptides spanning the HPA-1a polymorphism are efficiently generated and displayed from platelet glycoprotein by HLA-DRB3*0101-positive antigen-presenting cells. Blood. 2009 Aug 27;114(9):1954-7. doi: 10.1182/blood-2009-04-211839. Epub 2009 Jun 3. 19494351
  37. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. 19159218
  38. Bledzka K, Bialkowska K, Nie H, Qin J, Byzova T, Wu C, Plow EF, Ma YQ: Tyrosine phosphorylation of integrin beta3 regulates kindlin-2 binding and integrin activation. J Biol Chem. 2010 Oct 1;285(40):30370-4. doi: 10.1074/jbc.C110.134247. Epub 2010 Aug 11. 20702409
  39. Schmidt K, Keller M, Bader BL, Korytar T, Finke S, Ziegler U, Groschup MH: Integrins modulate the infection efficiency of West Nile virus into cells. J Gen Virol. 2013 Aug;94(Pt 8):1723-33. doi: 10.1099/vir.0.052613-0. Epub 2013 May 8. 23658209
  40. Wei Y, Zhang Y, Cai H, Mirza AM, Iorio RM, Peeples ME, Niewiesk S, Li J: Roles of the putative integrin-binding motif of the human metapneumovirus fusion (f) protein in cell-cell fusion, viral infectivity, and pathogenesis. J Virol. 2014 Apr;88(8):4338-52. doi: 10.1128/JVI.03491-13. Epub 2014 Jan 29. 24478423
  41. Xiong JP, Stehle T, Diefenbach B, Zhang R, Dunker R, Scott DL, Joachimiak A, Goodman SL, Arnaout MA: Crystal structure of the extracellular segment of integrin alpha Vbeta3. Science. 2001 Oct 12;294(5541):339-45. Epub 2001 Sep 6. 11546839
  42. Parry CS, Gorski J, Stern LJ: Crystallographic structure of the human leukocyte antigen DRA, DRB3*0101: models of a directional alloimmune response and autoimmunity. J Mol Biol. 2007 Aug 10;371(2):435-46. Epub 2007 May 18. 17583734
  43. Bray PF: Inherited diseases of platelet glycoproteins: considerations for rapid molecular characterization. Thromb Haemost. 1994 Oct;72(4):492-502. 7878622
  44. Newman PJ, Derbes RS, Aster RH: The human platelet alloantigens, PlA1 and PlA2, are associated with a leucine33/proline33 amino acid polymorphism in membrane glycoprotein IIIa, and are distinguishable by DNA typing. J Clin Invest. 1989 May;83(5):1778-81. 2565345
  45. Wang R, Furihata K, McFarland JG, Friedman K, Aster RH, Newman PJ: An amino acid polymorphism within the RGD binding domain of platelet membrane glycoprotein IIIa is responsible for the formation of the Pena/Penb alloantigen system. J Clin Invest. 1992 Nov;90(5):2038-43. 1430225
  46. Kuijpers RW, Simsek S, Faber NM, Goldschmeding R, van Wermerkerken RK, von dem Borne AE: Single point mutation in human glycoprotein IIIa is associated with a new platelet-specific alloantigen (Mo) involved in neonatal alloimmune thrombocytopenia. Blood. 1993 Jan 1;81(1):70-6. 8093349
  47. Wang R, McFarland JG, Kekomaki R, Newman PJ: Amino acid 489 is encoded by a mutational "hot spot" on the beta 3 integrin chain: the CA/TU human platelet alloantigen system. Blood. 1993 Dec 1;82(11):3386-91. 7694683
  48. Santoso S, Kalb R, Kroll H, Walka M, Kiefel V, Mueller-Eckhardt C, Newman PJ: A point mutation leads to an unpaired cysteine residue and a molecular weight polymorphism of a functional platelet beta 3 integrin subunit. The Sra alloantigen system of GPIIIa. J Biol Chem. 1994 Mar 18;269(11):8439-44. 8132570
  49. Loftus JC, O'Toole TE, Plow EF, Glass A, Frelinger AL 3rd, Ginsberg MH: A beta 3 integrin mutation abolishes ligand binding and alters divalent cation-dependent conformation. Science. 1990 Aug 24;249(4971):915-8. 2392682
  50. Bajt ML, Ginsberg MH, Frelinger AL 3rd, Berndt MC, Loftus JC: A spontaneous mutation of integrin alpha IIb beta 3 (platelet glycoprotein IIb-IIIa) helps define a ligand binding site. J Biol Chem. 1992 Feb 25;267(6):3789-94. 1371279
  51. Lanza F, Stierle A, Fournier D, Morales M, Andre G, Nurden AT, Cazenave JP: A new variant of Glanzmann's thrombasthenia (Strasbourg I). Platelets with functionally defective glycoprotein IIb-IIIa complexes and a glycoprotein IIIa 214Arg----214Trp mutation. J Clin Invest. 1992 Jun;89(6):1995-2004. 1602006
  52. Chen YP, Djaffar I, Pidard D, Steiner B, Cieutat AM, Caen JP, Rosa JP: Ser-752-->Pro mutation in the cytoplasmic domain of integrin beta 3 subunit and defective activation of platelet integrin alpha IIb beta 3 (glycoprotein IIb-IIIa) in a variant of Glanzmann thrombasthenia. Proc Natl Acad Sci U S A. 1992 Nov 1;89(21):10169-73. 1438206
  53. Grimaldi CM, Chen F, Scudder LE, Coller BS, French DL: A Cys374Tyr homozygous mutation of platelet glycoprotein IIIa (beta 3) in a Chinese patient with Glanzmann's thrombasthenia. Blood. 1996 Sep 1;88(5):1666-75. 8781422
  54. Basani RB, Brown DL, Vilaire G, Bennett JS, Poncz M: A Leu117-->Trp mutation within the RGD-peptide cross-linking region of beta3 results in Glanzmann thrombasthenia by preventing alphaIIb beta3 export to the platelet surface. Blood. 1997 Oct 15;90(8):3082-8. 9376589
  55. French DL, Coller BS: Hematologically important mutations: Glanzmann thrombasthenia. Blood Cells Mol Dis. 1997;23(1):39-51. 9215749
  56. Ambo H, Kamata T, Handa M, Taki M, Kuwajima M, Kawai Y, Oda A, Murata M, Takada Y, Watanabe K, Ikeda Y: Three novel integrin beta3 subunit missense mutations (H280P, C560F, and G579S) in thrombasthenia, including one (H280P) prevalent in Japanese patients. Biochem Biophys Res Commun. 1998 Oct 29;251(3):763-8. 9790984
  57. Jackson DE, White MM, Jennings LK, Newman PJ: A Ser162-->Leu mutation within glycoprotein (GP) IIIa (integrin beta3) results in an unstable alphaIIbbeta3 complex that retains partial function in a novel form of type II Glanzmann thrombasthenia. Thromb Haemost. 1998 Jul;80(1):42-8. 9684783
  58. Ruan J, Schmugge M, Clemetson KJ, Cazes E, Combrie R, Bourre F, Nurden AT: Homozygous Cys542-->Arg substitution in GPIIIa in a Swiss patient with type I Glanzmann's thrombasthenia. Br J Haematol. 1999 May;105(2):523-31. 10233432
  59. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. 10391209
  60. Ruiz C, Liu CY, Sun QH, Sigaud-Fiks M, Fressinaud E, Muller JY, Nurden P, Nurden AT, Newman PJ, Valentin N: A point mutation in the cysteine-rich domain of glycoprotein (GP) IIIa results in the expression of a GPIIb-IIIa (alphaIIbbeta3) integrin receptor locked in a high-affinity state and a Glanzmann thrombasthenia-like phenotype. Blood. 2001 Oct 15;98(8):2432-41. 11588040
  61. Jallu V, Meunier M, Brement M, Kaplan C: A new platelet polymorphism Duv(a+), localized within the RGD binding domain of glycoprotein IIIa, is associated with neonatal thrombocytopenia. Blood. 2002 Jun 15;99(12):4449-56. 12036875
  62. Nurden AT, Ruan J, Pasquet JM, Gauthier B, Combrie R, Kunicki T, Nurden P: A novel 196Leu to Pro substitution in the beta3 subunit of the alphaIIbbeta3 integrin in a patient with a variant form of Glanzmann thrombasthenia. Platelets. 2002 Mar;13(2):101-11. 11897046
  63. D'Andrea G, Colaizzo D, Vecchione G, Grandone E, Di Minno G, Margaglione M: Glanzmann's thrombasthenia: identification of 19 new mutations in 30 patients. Thromb Haemost. 2002 Jun;87(6):1034-42. 12083483
  64. Nair S, Li J, Mitchell WB, Mohanty D, Coller BS, French DL: Two new beta3 integrin mutations in Indian patients with Glanzmann thrombasthenia: localization of mutations affecting cysteine residues in integrin beta3. Thromb Haemost. 2002 Sep;88(3):503-9. 12353082
  65. Gonzalez-Manchon C, Butta N, Larrucea S, Arias-Salgado EG, Alonso S, Lopez A, Parrilla R: A variant thrombasthenic phenotype associated with compound heterozygosity of integrin beta3-subunit: (Met124Val)beta3 alters the subunit dimerization rendering a decreased number of constitutive active alphaIIbbeta3 receptors. Thromb Haemost. 2004 Dec;92(6):1377-86. 15583747
  66. Tanaka S, Hayashi T, Yoshimura K, Nakayama M, Fujita T, Amano T, Tani Y: Double heterozygosity for a novel missense mutation of Ile304 to Asn in addition to the missense mutation His280 to Pro in the integrin beta3 gene as a cause of the absence of platelet alphaIIbbeta3 in Glanzmann's thrombasthenia. J Thromb Haemost. 2005 Jan;3(1):68-73. 15634267
  67. Nair S, Ghosh K, Shetty S, Mohanty D: Mutations in GPIIIa molecule as a cause for Glanzmann thrombasthenia in Indian patients. J Thromb Haemost. 2005 Mar;3(3):482-8. 15748237
  68. Ghevaert C, Salsmann A, Watkins NA, Schaffner-Reckinger E, Rankin A, Garner SF, Stephens J, Smith GA, Debili N, Vainchenker W, de Groot PG, Huntington JA, Laffan M, Kieffer N, Ouwehand WH: A nonsynonymous SNP in the ITGB3 gene disrupts the conserved membrane-proximal cytoplasmic salt bridge in the alphaIIbbeta3 integrin and cosegregates dominantly with abnormal proplatelet formation and macrothrombocytopenia. Blood. 2008 Apr 1;111(7):3407-14. Epub 2007 Dec 7. 18065693
  69. Jallu V, Dusseaux M, Panzer S, Torchet MF, Hezard N, Goudemand J, de Brevern AG, Kaplan C: AlphaIIbbeta3 integrin: new allelic variants in Glanzmann thrombasthenia, effects on ITGA2B and ITGB3 mRNA splicing, expression, and structure-function. Hum Mutat. 2010 Mar;31(3):237-46. doi: 10.1002/humu.21179. 20020534