Name | Triosephosphate isomerase, glycosomal |
---|
Synonyms | |
---|
Gene Name | Not Available |
---|
Organism | Trypanosoma brucei brucei |
---|
Amino acid sequence | >lcl|BSEQ0017682|Triosephosphate isomerase, glycosomal
MSKPQPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVASTFVHLAMTKERLSHPKF
VIAAQNAIAKSGAFTGEVSLPILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVASG
FMVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPVWAIGTGKVATP
QQAQEAHALIRSWVSSKIGADVAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASLKP
EFVDIIKATQ |
---|
Number of residues | 250 |
---|
Molecular Weight | 26834.665 |
---|
Theoretical pI | Not Available |
---|
GO Classification | Functions - triose-phosphate isomerase activity
Processes - pentose-phosphate shunt
- gluconeogenesis
- glycolytic process
Components |
---|
General Function | Triose-phosphate isomerase activity |
---|
Specific Function | Not Available |
---|
Pfam Domain Function | |
---|
Transmembrane Regions | Not Available |
---|
GenBank Protein ID | Not Available |
---|
UniProtKB ID | P04789 |
---|
UniProtKB Entry Name | TPIS_TRYBB |
---|
Cellular Location | Glycosome |
---|
Gene sequence | Not Available |
---|
GenBank Gene ID | Not Available |
---|
GeneCard ID | Not Available |
---|
GenAtlas ID | Not Available |
---|
HGNC ID | Not Available |
---|
Chromosome Location | Not Available |
---|
Locus | Not Available |
---|
References | - Swinkels BW, Gibson WC, Osinga KA, Kramer R, Veeneman GH, van Boom JH, Borst P: Characterization of the gene for the microbody (glycosomal) triosephosphate isomerase of Trypanosoma brucei. EMBO J. 1986 Jun;5(6):1291-8. 3015595
- Borst P: How proteins get into microbodies (peroxisomes, glyoxysomes, glycosomes). Biochim Biophys Acta. 1986 May 5;866(4):179-203. 3516224
- Wierenga RK, Kalk KH, Hol WG: Structure determination of the glycosomal triosephosphate isomerase from Trypanosoma brucei brucei at 2.4 A resolution. J Mol Biol. 1987 Nov 5;198(1):109-21. 3430602
- Wierenga RK, Noble ME, Vriend G, Nauche S, Hol WG: Refined 1.83 A structure of trypanosomal triosephosphate isomerase crystallized in the presence of 2.4 M-ammonium sulphate. A comparison with the structure of the trypanosomal triosephosphate isomerase-glycerol-3-phosphate complex. J Mol Biol. 1991 Aug 20;220(4):995-1015. 1880808
- Noble ME, Wierenga RK, Lambeir AM, Opperdoes FR, Thunnissen AM, Kalk KH, Groendijk H, Hol WG: The adaptability of the active site of trypanosomal triosephosphate isomerase as observed in the crystal structures of three different complexes. Proteins. 1991;10(1):50-69. 2062828
- Wierenga RK, Noble ME, Davenport RC: Comparison of the refined crystal structures of liganded and unliganded chicken, yeast and trypanosomal triosephosphate isomerase. J Mol Biol. 1992 Apr 20;224(4):1115-26. 1569570
- Borchert TV, Pratt K, Zeelen JP, Callens M, Noble ME, Opperdoes FR, Michels PA, Wierenga RK: Overexpression of trypanosomal triosephosphate isomerase in Escherichia coli and characterisation of a dimer-interface mutant. Eur J Biochem. 1993 Feb 1;211(3):703-10. 8436128
- Borchert TV, Kishan KV, Zeelen JP, Schliebs W, Thanki N, Abagyan R, Jaenicke R, Wierenga RK: Three new crystal structures of point mutation variants of monoTIM: conformational flexibility of loop-1, loop-4 and loop-8. Structure. 1995 Jul 15;3(7):669-79. 8591044
- Kursula I, Partanen S, Lambeir AM, Wierenga RK: The importance of the conserved Arg191-Asp227 salt bridge of triosephosphate isomerase for folding, stability, and catalysis. FEBS Lett. 2002 May 8;518(1-3):39-42. 11997014
|
---|