NameMyelin basic protein
Synonyms
  • MBP
  • Myelin A1 protein
  • Myelin membrane encephalitogenic protein
Gene NameMBP
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009023|Myelin basic protein
MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQ
DTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTI
QEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFG
GDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKG
RGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSP
MARR
Number of residues304
Molecular Weight33116.855
Theoretical pINot Available
GO Classification
Functions
  • structural constituent of myelin sheath
Processes
  • axon ensheathment
  • immune response
  • synaptic transmission
  • membrane organization
  • response to toxic substance
  • myelination
  • substantia nigra development
  • central nervous system development
Components
  • compact myelin
  • nucleus
  • plasma membrane
  • neuronal cell body
  • cell periphery
  • internode region of axon
General FunctionStructural constituent of myelin sheath
Specific FunctionThe classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. Differential splicing events combined with optional post-translational modifications give a wide spectrum of isomers, with each of them potentially having a specialized function. Induces T-cell proliferation.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP02686
UniProtKB Entry NameMBP_HUMAN
Cellular LocationMyelin membrane
Gene sequence
>lcl|BSEQ0013569|Myelin basic protein (MBP)
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGT
ACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGAC
TCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTA
CCCTGGCTAAAGCCGGGCCGGAGCCCTCTGCCCTCTCATGCCCGCAGCCAGCCTGGGCTG
TGCAACATGTACAAGGACTCACACCACCCGGCAAGAACTGCTCACTACGGCTCCCTGCCC
CAGAAGTCACACGGCCGGACCCAAGATGAAAACCCCGTAGTCCACTTCTTCAAGAACATT
GTGACGCCTCGCACACCACCCCCGTCGCAGGGAAAGGGGAGAGGACTGTCCCTGAGCAGA
TTTAGCTGGGGGGCCGAAGGCCAGAGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGAC
TATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTTTCCAAAATT
TTTAAGCTGGGAGGAAGAGATAGTCGCTCTGGATCACCCATGGCTAGACGCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:6925
Chromosome Location18
LocusNot Available
References
  1. Carnegie PR: Amino acid sequence of the encephalitogenic basic protein from human myelin. Biochem J. 1971 Jun;123(1):57-67. 4108501
  2. Roth HJ, Kronquist K, Pretorius PJ, Crandall BF, Campagnoni AT: Isolation and characterization of a cDNA coding for a novel human 17.3K myelin basic protein (MBP) variant. J Neurosci Res. 1986;16(1):227-38. 2427738
  3. Kamholz J, de Ferra F, Puckett C, Lazzarini R: Identification of three forms of human myelin basic protein by cDNA cloning. Proc Natl Acad Sci U S A. 1986 Jul;83(13):4962-6. 2425357
  4. Roth HJ, Kronquist KE, Kerlero de Rosbo N, Crandall BF, Campagnoni AT: Evidence for the expression of four myelin basic protein variants in the developing human spinal cord through cDNA cloning. J Neurosci Res. 1987;17(4):321-8. 2442403
  5. Streicher R, Stoffel W: The organization of the human myelin basic protein gene. Comparison with the mouse gene. Biol Chem Hoppe Seyler. 1989 May;370(5):503-10. 2472816
  6. Pribyl TM, Campagnoni CW, Kampf K, Kashima T, Handley VW, McMahon J, Campagnoni AT: The human myelin basic protein gene is included within a 179-kilobase transcription unit: expression in the immune and central nervous systems. Proc Natl Acad Sci U S A. 1993 Nov 15;90(22):10695-9. 7504278
  7. Nye SH, Pelfrey CM, Burkwit JJ, Voskuhl RR, Lenardo MJ, Mueller JP: Purification of immunologically active recombinant 21.5 kDa isoform of human myelin basic protein. Mol Immunol. 1995 Oct;32(14-15):1131-41. 8544862
  8. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  9. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  10. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. 16177791
  11. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  12. Boylan KB, Ayres TM, Popko B, Takahashi N, Hood LE, Prusiner SB: Repetitive DNA (TGGA)n 5' to the human myelin basic protein gene: a new form of oligonucleotide repetitive sequence showing length polymorphism. Genomics. 1990 Jan;6(1):16-22. 1689270
  13. Scoble HA, Whitaker JN, Biemann K: Analysis of the primary sequence of human myelin basic protein peptides 1-44 and 90-170 by fast atom bombardment mass spectrometry. J Neurochem. 1986 Aug;47(2):614-6. 2426402
  14. Wood DD, Moscarello MA: The isolation, characterization, and lipid-aggregating properties of a citrulline containing myelin basic protein. J Biol Chem. 1989 Mar 25;264(9):5121-7. 2466844
  15. Boulias C, Pang H, Mastronardi F, Moscarello MA: The isolation and characterization of four myelin basic proteins from the unbound fraction during CM52 chromatography. Arch Biochem Biophys. 1995 Sep 10;322(1):174-82. 7574672
  16. Gibson BW, Gilliom RD, Whitaker JN, Biemann K: Amino acid sequence of human myelin basic protein peptide 45-89 as determined by mass spectrometry. J Biol Chem. 1984 Apr 25;259(8):5028-31. 6201481
  17. Lennon VA, Wilks AV, Carnegie PR: Immunologic properties of the main encephalitogenic peptide from the basic protein of human myelin. J Immunol. 1970 Nov;105(5):1223-30. 4099924
  18. Proost P, Van Damme J, Opdenakker G: Leukocyte gelatinase B cleavage releases encephalitogens from human myelin basic protein. Biochem Biophys Res Commun. 1993 May 14;192(3):1175-81. 7685161
  19. Baldwin GS, Carnegie PR: Isolation and partial characterization of methylated arginines from the encephalitogenic basic protein of myelin. Biochem J. 1971 Jun;123(1):69-74. 5128665
  20. Enslen H, Raingeaud J, Davis RJ: Selective activation of p38 mitogen-activated protein (MAP) kinase isoforms by the MAP kinase kinases MKK3 and MKK6. J Biol Chem. 1998 Jan 16;273(3):1741-8. 9430721
  21. Maucuer A, Le Caer JP, Manceau V, Sobel A: Specific Ser-Pro phosphorylation by the RNA-recognition motif containing kinase KIS. Eur J Biochem. 2000 Jul;267(14):4456-64. 10880969
  22. Moore TM, Garg R, Johnson C, Coptcoat MJ, Ridley AJ, Morris JD: PSK, a novel STE20-like kinase derived from prostatic carcinoma that activates the c-Jun N-terminal kinase mitogen-activated protein kinase pathway and regulates actin cytoskeletal organization. J Biol Chem. 2000 Feb 11;275(6):4311-22. 10660600
  23. Nicke B, Bastien J, Khanna SJ, Warne PH, Cowling V, Cook SJ, Peters G, Delpuech O, Schulze A, Berns K, Mullenders J, Beijersbergen RL, Bernards R, Ganesan TS, Downward J, Hancock DC: Involvement of MINK, a Ste20 family kinase, in Ras oncogene-induced growth arrest in human ovarian surface epithelial cells. Mol Cell. 2005 Dec 9;20(5):673-85. 16337592
  24. Blanco S, Klimcakova L, Vega FM, Lazo PA: The subcellular localization of vaccinia-related kinase-2 (VRK2) isoforms determines their different effect on p53 stability in tumour cell lines. FEBS J. 2006 Jun;273(11):2487-504. 16704422
  25. Zihni C, Mitsopoulos C, Tavares IA, Baum B, Ridley AJ, Morris JD: Prostate-derived sterile 20-like kinase 1-alpha induces apoptosis. JNK- and caspase-dependent nuclear localization is a requirement for membrane blebbing. J Biol Chem. 2007 Mar 2;282(9):6484-93. Epub 2006 Dec 11. 17158878
  26. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  27. Smith GS, Seymour LV, Boggs JM, Harauz G: The 21.5-kDa isoform of myelin basic protein has a non-traditional PY-nuclear-localization signal. Biochem Biophys Res Commun. 2012 Jun 15;422(4):670-5. doi: 10.1016/j.bbrc.2012.05.051. Epub 2012 May 16. 22609403
  28. Jin Z, Fu Z, Yang J, Troncosco J, Everett AD, Van Eyk JE: Identification and characterization of citrulline-modified brain proteins by combining HCD and CID fragmentation. Proteomics. 2013 Sep;13(17):2682-91. doi: 10.1002/pmic.201300064. Epub 2013 Aug 7. 23828821
  29. Mendz GL, Barden JA, Martenson RE: Conformation of a tetradecapeptide epitope of myelin basic protein. Eur J Biochem. 1995 Aug 1;231(3):659-66. 7544282
  30. Ridsdale RA, Beniac DR, Tompkins TA, Moscarello MA, Harauz G: Three-dimensional structure of myelin basic protein. II. Molecular modeling and considerations of predicted structures in multiple sclerosis. J Biol Chem. 1997 Feb 14;272(7):4269-75. 9020143
  31. Li Y, Li H, Martin R, Mariuzza RA: Structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two HLA-DR2 proteins. J Mol Biol. 2000 Nov 24;304(2):177-88. 11080454
  32. Li Y, Li H, Dimasi N, McCormick JK, Martin R, Schuck P, Schlievert PM, Mariuzza RA: Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on MHC class II. Immunity. 2001 Jan;14(1):93-104. 11163233
  33. Li Y, Huang Y, Lue J, Quandt JA, Martin R, Mariuzza RA: Structure of a human autoimmune TCR bound to a myelin basic protein self-peptide and a multiple sclerosis-associated MHC class II molecule. EMBO J. 2005 Sep 7;24(17):2968-79. Epub 2005 Aug 4. 16079912