Hemoglobin subunit zeta

NameHemoglobin subunit zeta
Synonyms
  • HBAZ
  • HBZ2
  • Hemoglobin zeta chain
  • Zeta-globin
Gene NameHBZ
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017595|Hemoglobin subunit zeta
MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHG
SKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTA
EAHAAWDKFLSVVSSVLTEKYR
Number of residues142
Molecular Weight15636.845
Theoretical pINot Available
GO Classification
Functions
  • iron ion binding
  • heme binding
  • oxygen binding
  • oxygen transporter activity
Processes
  • negative regulation of transcription from RNA polymerase II promoter
  • erythrocyte maturation
Components
  • hemoglobin complex
  • extracellular exosome
General FunctionOxygen transporter activity
Specific FunctionThe zeta chain is an alpha-type chain of mammalian embryonic hemoglobin.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP02008
UniProtKB Entry NameHBAZ_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0017596|Hemoglobin subunit zeta (HBZ)
ATGTCTCTGACCAAGACTGAGAGGACCATCATTGTGTCCATGTGGGCCAAGATCTCCACG
CAGGCCGACACCATCGGCACCGAGACTCTGGAGAGGCTCTTCCTCAGCCACCCGCAGACC
AAGACCTACTTCCCGCACTTCGACCTGCACCCGGGGTCCGCGCAGTTGCGCGCGCACGGC
TCCAAGGTGGTGGCCGCCGTGGGCGACGCGGTGAAGAGCATCGACGACATCGGCGGCGCC
CTGTCCAAGCTGAGCGAGCTGCACGCCTACATCCTGCGCGTGGACCCGGTCAACTTCAAG
CTCCTGTCCCACTGCCTGCTGGTCACCCTGGCCGCGCGCTTCCCCGCCGACTTCACGGCC
GAGGCCCACGCCGCCTGGGACAAGTTCCTATCGGTCGTATCCTCTGTCCTGACCGAGAAG
TACCGCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:4835
Chromosome Location16
LocusNot Available
References
  1. Proudfoot NJ, Gil A, Maniatis T: The structure of the human zeta-globin gene and a closely linked, nearly identical pseudogene. Cell. 1982 Dec;31(3 Pt 2):553-63. 6297773
  2. Cohen-Solal MM, Authier B, deRiel JK, Murnane MJ, Forget BG: Cloning and nucleotide sequence analysis of human embryonic zeta-globin cDNA. DNA. 1982;1(4):355-63. 6963223
  3. Flint J, Thomas K, Micklem G, Raynham H, Clark K, Doggett NA, King A, Higgs DR: The relationship between chromosome structure and function at a human telomeric region. Nat Genet. 1997 Mar;15(3):252-7. 9054936
  4. Daniels RJ, Peden JF, Lloyd C, Horsley SW, Clark K, Tufarelli C, Kearney L, Buckle VJ, Doggett NA, Flint J, Higgs DR: Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16. Hum Mol Genet. 2001 Feb 15;10(4):339-52. 11157797
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Aschauer H, Sanguansermsri T, Braunitzer G: [Human embryonic haemoglobins. The primary structure of the zeta chains (author's transl)]. Hoppe Seylers Z Physiol Chem. 1981 Aug;362(8):1159-62. 6179844
  7. Clegg JB, Gagnon J: Structure of the zeta chain of human embryonic hemoglobin. Proc Natl Acad Sci U S A. 1981 Oct;78(10):6076-80. 6171809
  8. Aschauer H, Schafer W, Sanguansermsri T, Braunitzer G: [Human embryonic haemoglobins. Ac-Ser-Leu-Thr-is the N-terminal sequence of the zeta-chains (author's transl)]. Hoppe Seylers Z Physiol Chem. 1981 Dec;362(12):1657-9. 6172357
  9. Randhawa ZI, Jones RT, Lie-Injo LE: Human hemoglobin Portland II (zeta 2 beta 2). Isolation and characterization of Portland hemoglobin components and their constituent globin chains. J Biol Chem. 1984 Jun 10;259(11):7325-30. 6539334
  10. Kutlar F, Moscoso H, Kiefer CR, Garver FA, Beksac S, Onderoglu L, Gurgey A, Altay C, Huisman TH: Quantities of adult, fetal and embryonic globin chains in the blood of eighteen- to twenty-week-old human fetuses. J Chromatogr. 1991 Jul 5;567(2):359-68. 1939469
  11. Li TK, Leung KY, Lam YH, Tang MH, Chan V: Haemoglobin level, proportion of haemoglobin Bart's and haemoglobin Portland in fetuses affected by homozygous alpha0-thalassemia from 12 to 40 weeks' gestation. Prenat Diagn. 2010 Dec;30(12-13):1126-30. doi: 10.1002/pd.2619. 20925047
  12. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  13. Kidd RD, Russell JE, Watmough NJ, Baker EN, Brittain T: The role of beta chains in the control of the hemoglobin oxygen binding function: chimeric human/mouse proteins, structure, and function. Biochemistry. 2001 Dec 25;40(51):15669-75. 11747442
  14. Safo MK, Ko TP, Abdulmalik O, He Z, Wang AH, Schreiter ER, Russell JE: Structure of fully liganded Hb zeta2beta2s trapped in a tense conformation. Acta Crystallogr D Biol Crystallogr. 2013 Oct;69(Pt 10):2061-71. doi: 10.1107/S0907444913019197. Epub 2013 Sep 20. 24100324