NameFibroblast growth factor 19
Synonyms
  • FGF-19
Gene NameFGF19
OrganismHuman
Amino acid sequence
>lcl|BSEQ0021469|Fibroblast growth factor 19
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFL
RIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDC
AFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLR
GHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Number of residues216
Molecular Weight24002.345
Theoretical pINot Available
GO Classification
Functions
  • fibroblast growth factor receptor binding
Processes
  • epidermal growth factor receptor signaling pathway
  • neural crest cell migration
  • innate immune response
  • negative regulation of gene expression
  • positive regulation of protein phosphorylation
  • positive regulation of JNK cascade
  • Fc-epsilon receptor signaling pathway
  • positive regulation of glucose import
  • activation of MAPKK activity
  • negative regulation of bile acid biosynthetic process
  • fibroblast growth factor receptor signaling pathway
  • heart development
  • insulin receptor signaling pathway
  • MAPK cascade
  • neurotrophin TRK receptor signaling pathway
  • Ras protein signal transduction
  • vascular endothelial growth factor receptor signaling pathway
  • nervous system development
  • positive regulation of cell proliferation
  • small GTPase mediated signal transduction
  • phosphatidylinositol-mediated signaling
  • axon guidance
  • positive regulation of ERK1 and ERK2 cascade
Components
  • intracellular
  • extracellular region
General FunctionFibroblast growth factor receptor binding
Specific FunctionInvolved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDO95750
UniProtKB Entry NameFGF19_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0021470|Fibroblast growth factor 19 (FGF19)
ATGCGGAGCGGGTGTGTGGTGGTCCACGTATGGATCCTGGCCGGCCTCTGGCTGGCCGTG
GCCGGGCGCCCCCTCGCCTTCTCGGACGCGGGGCCCCACGTGCACTACGGCTGGGGCGAC
CCCATCCGCCTGCGGCACCTGTACACCTCCGGCCCCCACGGGCTCTCCAGCTGCTTCCTG
CGCATCCGTGCCGACGGCGTCGTGGACTGCGCGCGGGGCCAGAGCGCGCACAGTTTGCTG
GAGATCAAGGCAGTCGCTCTGCGGACCGTGGCCATCAAGGGCGTGCACAGCGTGCGGTAC
CTCTGCATGGGCGCCGACGGCAAGATGCAGGGGCTGCTTCAGTACTCGGAGGAAGACTGT
GCTTTCGAGGAGGAGATCCGCCCAGATGGCTACAATGTGTACCGATCCGAGAAGCACCGC
CTCCCGGTCTCCCTGAGCAGTGCCAAACAGCGGCAGCTGTACAAGAACAGAGGCTTTCTT
CCACTCTCTCATTTCCTGCCCATGCTGCCCATGGTCCCAGAGGAGCCTGAGGACCTCAGG
GGCCACTTGGAATCTGACATGTTCTCTTCGCCCCTGGAGACCGACAGCATGGACCCATTT
GGGCTTGTCACCGGACTGGAGGCCGTGAGGAGTCCCAGCTTTGAGAAGTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:3675
Chromosome Location11
LocusNot Available
References
  1. Nishimura T, Utsunomiya Y, Hoshikawa M, Ohuchi H, Itoh N: Structure and expression of a novel human FGF, FGF-19, expressed in the fetal brain. Biochim Biophys Acta. 1999 Jan 18;1444(1):148-51. 9931477
  2. Xie MH, Holcomb I, Deuel B, Dowd P, Huang A, Vagts A, Foster J, Liang J, Brush J, Gu Q, Hillan K, Goddard A, Gurney AL: FGF-19, a novel fibroblast growth factor with unique specificity for FGFR4. Cytokine. 1999 Oct;11(10):729-35. 10525310
  3. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. 12975309
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. 15340161
  6. Holt JA, Luo G, Billin AN, Bisi J, McNeill YY, Kozarsky KF, Donahee M, Wang DY, Mansfield TA, Kliewer SA, Goodwin B, Jones SA: Definition of a novel growth factor-dependent signal cascade for the suppression of bile acid biosynthesis. Genes Dev. 2003 Jul 1;17(13):1581-91. Epub 2003 Jun 18. 12815072
  7. Zhang X, Ibrahimi OA, Olsen SK, Umemori H, Mohammadi M, Ornitz DM: Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family. J Biol Chem. 2006 Jun 9;281(23):15694-700. Epub 2006 Apr 4. 16597617
  8. Kurosu H, Choi M, Ogawa Y, Dickson AS, Goetz R, Eliseenkova AV, Mohammadi M, Rosenblatt KP, Kliewer SA, Kuro-o M: Tissue-specific expression of betaKlotho and fibroblast growth factor (FGF) receptor isoforms determines metabolic activity of FGF19 and FGF21. J Biol Chem. 2007 Sep 14;282(37):26687-95. Epub 2007 Jul 10. 17623664
  9. Wu X, Lemon B, Li X, Gupte J, Weiszmann J, Stevens J, Hawkins N, Shen W, Lindberg R, Chen JL, Tian H, Li Y: C-terminal tail of FGF19 determines its specificity toward Klotho co-receptors. J Biol Chem. 2008 Nov 28;283(48):33304-9. doi: 10.1074/jbc.M803319200. Epub 2008 Oct 1. 18829467
  10. Song KH, Li T, Owsley E, Strom S, Chiang JY: Bile acids activate fibroblast growth factor 19 signaling in human hepatocytes to inhibit cholesterol 7alpha-hydroxylase gene expression. Hepatology. 2009 Jan;49(1):297-305. doi: 10.1002/hep.22627. 19085950
  11. Turner N, Grose R: Fibroblast growth factor signalling: from development to cancer. Nat Rev Cancer. 2010 Feb;10(2):116-29. doi: 10.1038/nrc2780. 20094046
  12. Harmer NJ, Pellegrini L, Chirgadze D, Fernandez-Recio J, Blundell TL: The crystal structure of fibroblast growth factor (FGF) 19 reveals novel features of the FGF family and offers a structural basis for its unusual receptor affinity. Biochemistry. 2004 Jan 27;43(3):629-40. 14730967
  13. Goetz R, Beenken A, Ibrahimi OA, Kalinina J, Olsen SK, Eliseenkova AV, Xu C, Neubert TA, Zhang F, Linhardt RJ, Yu X, White KE, Inagaki T, Kliewer SA, Yamamoto M, Kurosu H, Ogawa Y, Kuro-o M, Lanske B, Razzaque MS, Mohammadi M: Molecular insights into the klotho-dependent, endocrine mode of action of fibroblast growth factor 19 subfamily members. Mol Cell Biol. 2007 May;27(9):3417-28. Epub 2007 Mar 5. 17339340