NameRho-related GTP-binding protein RhoH
Synonyms
  • ARHH
  • GTP-binding protein TTF
  • Translocation three four protein
  • TTF
Gene NameRHOH
OrganismHuman
Amino acid sequence
>lcl|BSEQ0019720|Rho-related GTP-binding protein RhoH
MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTA
GNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQ
REMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRR
RLFSINECKIF
Number of residues191
Molecular Weight21330.35
Theoretical pINot Available
GO Classification
Functions
  • Rho GTPase binding
  • GTPase inhibitor activity
  • GTP binding
  • kinase inhibitor activity
Processes
  • regulation of small GTPase mediated signal transduction
  • negative regulation of GTPase activity
  • T cell differentiation
  • negative regulation of phosphorylation
  • small GTPase mediated signal transduction
  • regulation of transcription, DNA-templated
  • mast cell activation
  • negative regulation of I-kappaB kinase/NF-kappaB signaling
Components
  • cytoplasm
  • plasma membrane
  • cytosol
  • immunological synapse
General FunctionRho gtpase binding
Specific FunctionNegative regulator of hematopoietic progenitor cell proliferation, survival and migration. Critical regulator of thymocyte development and T-cell antigen receptor (TCR) signaling by mediating recruitment and activation of ZAP70. Required for phosphorylation of CD3Z, membrane translocation of ZAP70 and subsequent activation of the ZAP70-mediated pathways. Essential for efficient beta-selection and positive selection by promoting the ZAP70-dependent phosphorylation of the LAT signalosome during pre-TCR and TCR signaling. Crucial for thymocyte maturation during DN3 to DN4 transition and during positive selection. Plays critical roles in mast cell function by facilitating phosphorylation of SYK in Fc epsilon RI-mediated signal transduction. Essential for the phosphorylation of LAT, LCP2, PLCG1 and PLCG2 and for Ca(2+) mobilization in mast cells (By similarity). Binds GTP but lacks intrinsic GTPase activity and is resistant to Rho-specific GTPase-activating proteins. Inhibits the activation of NF-kappa-B by TNF and IKKB and the activation of CRK/p38 by TNF. Inhibits activities of RAC1, RHOA and CDC42. Negatively regulates leukotriene production in neutrophils.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ15669
UniProtKB Entry NameRHOH_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0019721|Rho-related GTP-binding protein RhoH (RHOH)
ATGCTGAGTTCCATCAAGTGCGTGTTGGTGGGCGACTCTGCTGTGGGGAAAACCTCTCTG
TTGGTGCGCTTCACCTCCGAGACCTTCCCGGAGGCCTACAAGCCCACAGTGTACGAGAAC
ACAGGGGTGGACGTCTTCATGGATGGCATCCAGATCAGCCTGGGCCTCTGGGACACAGCC
GGCAATGACGCCTTCAGAAGCATCCGGCCCCTGTCCTACCAGCAGGCAGACGTGGTGCTG
ATGTGCTACTCTGTGGCCAACCATAACTCATTCCTGAACTTGAAGAACAAGTGGATTGGT
GAAATTAGGAGCAACTTGCCCTGTACCCCTGTGCTGGTGGTGGCCACCCAGACTGACCAG
CGGGAGATGGGGCCCCACAGGGCCTCCTGCGTCAATGCCATGGAAGGGAAGAAACTGGCC
CAGGATGTCAGAGCCAAGGGCTACCTGGAGTGCTCAGCCCTTAGCAATCGGGGAGTACAG
CAGGTGTTTGAGTGCGCCGTCCGAACTGCCGTCAACCAGGCCAGGAGACGAAACAGAAGG
AGGCTCTTCTCCATCAATGAGTGCAAGATCTTCTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:686
Chromosome Location4
LocusNot Available
References
  1. Dallery E, Galiegue-Zouitina S, Collyn-d'Hooghe M, Quief S, Denis C, Hildebrand MP, Lantoine D, Deweindt C, Tilly H, Bastard C, et al.: TTF, a gene encoding a novel small G protein, fuses to the lymphoma-associated LAZ3 gene by t(3;4) chromosomal translocation. Oncogene. 1995 Jun 1;10(11):2171-8. 7784061
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Li X, Bu X, Lu B, Avraham H, Flavell RA, Lim B: The hematopoiesis-specific GTP-binding protein RhoH is GTPase deficient and modulates activities of other Rho GTPases by an inhibitory function. Mol Cell Biol. 2002 Feb;22(4):1158-71. 11809807
  4. Wu X, Frost JA: Multiple Rho proteins regulate the subcellular targeting of PAK5. Biochem Biophys Res Commun. 2006 Dec 15;351(2):328-35. Epub 2006 Oct 17. 17064668
  5. Daryadel A, Yousefi S, Troi D, Schmid I, Schmidt-Mende J, Mordasini C, Dahinden CA, Ziemiecki A, Simon HU: RhoH/TTF negatively regulates leukotriene production in neutrophils. J Immunol. 2009 May 15;182(10):6527-32. doi: 10.4049/jimmunol.0803846. 19414807