NameSonic hedgehog protein
Synonyms
  • HHG-1
  • SHH
Gene NameSHH
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013929|Sonic hedgehog protein
MLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLT
FLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG
PRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAPLTAQGTILINRVL
ASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVALTAPGA
ADAPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS
Number of residues462
Molecular Weight49606.685
Theoretical pINot Available
GO Classification
Functions
  • calcium ion binding
  • peptidase activity
  • morphogen activity
  • glycosaminoglycan binding
  • patched binding
  • laminin-1 binding
  • zinc ion binding
Processes
  • negative regulation of cell migration
  • smoothened signaling pathway involved in regulation of cerebellar granule cell precursor cell proliferation
  • midbrain development
  • cerebellar granule cell precursor proliferation
  • lung development
  • positive regulation of hh target transcription factor activity
  • spinal cord motor neuron differentiation
  • salivary gland cavitation
  • left lung development
  • positive regulation of alpha-beta T cell differentiation
  • somite development
  • positive regulation of Wnt signaling pathway
  • stem cell development
  • heart development
  • positive regulation of kidney smooth muscle cell differentiation
  • pancreas development
  • positive regulation of immature T cell proliferation in thymus
  • lung epithelium development
  • lymphoid progenitor cell differentiation
  • neural crest cell migration
  • striated muscle tissue development
  • prostate epithelial cord elongation
  • negative regulation of apoptotic process
  • positive regulation of mesenchymal cell proliferation involved in ureter development
  • androgen metabolic process
  • embryo development
  • mesenchymal smoothened signaling pathway involved in prostate gland development
  • patterning of blood vessels
  • telencephalon regionalization
  • vasculogenesis
  • determination of left/right asymmetry in lateral mesoderm
  • positive regulation of transcription from RNA polymerase II promoter
  • positive regulation of sclerotome development
  • prostate gland development
  • artery development
  • positive regulation of smoothened signaling pathway
  • positive regulation of protein import into nucleus
  • metanephric mesenchymal cell proliferation involved in metanephros development
  • apoptotic signaling pathway
  • thyroid gland development
  • branching involved in ureteric bud morphogenesis
  • positive regulation of striated muscle cell differentiation
  • smoothened signaling pathway
  • positive regulation of skeletal muscle cell proliferation
  • osteoblast development
  • negative regulation of canonical Wnt signaling pathway
  • establishment of cell polarity
  • multicellular structure septum development
  • negative thymic T cell selection
  • trachea morphogenesis
  • canonical Wnt signaling pathway
  • dorsal/ventral pattern formation
  • positive regulation of cell proliferation
  • positive regulation of T cell differentiation in thymus
  • myoblast differentiation
  • oligodendrocyte development
  • negative regulation of alpha-beta T cell differentiation
  • forebrain development
  • ventral midline development
  • cell fate specification
  • positive regulation of ureter smooth muscle cell differentiation
  • positive regulation of skeletal muscle tissue development
  • heart looping
  • cell-cell signaling
  • negative regulation of kidney smooth muscle cell differentiation
  • embryonic hindlimb morphogenesis
  • ectoderm development
  • cellular response to lithium ion
  • primary prostatic bud elongation
  • branching involved in salivary gland morphogenesis
  • embryonic digestive tract morphogenesis
  • metanephros development
  • negative regulation of mesenchymal cell apoptotic process
  • positive regulation of cell division
  • embryonic digit morphogenesis
  • bud outgrowth involved in lung branching
  • negative regulation of transcription from RNA polymerase II promoter
  • regulation of mesenchymal cell proliferation involved in prostate gland development
  • embryonic pattern specification
  • positive thymic T cell selection
  • negative regulation of transcription elongation from RNA polymerase II promoter
  • embryonic foregut morphogenesis
  • CD4-positive or CD8-positive, alpha-beta T cell lineage commitment
  • negative regulation of cell differentiation
  • regulation of nodal signaling pathway involved in determination of lateral mesoderm left/right asymmetry
  • epithelial cell proliferation involved in salivary gland morphogenesis
  • palate development
  • axon guidance
  • negative regulation of ureter smooth muscle cell differentiation
  • negative regulation of cholesterol efflux
  • embryonic forelimb morphogenesis
  • thalamus development
  • regulation of odontogenesis
  • hair follicle morphogenesis
  • Bergmann glial cell differentiation
  • regulation of cell proliferation
  • neuroblast proliferation
  • endocytosis
  • positive regulation of epithelial cell proliferation involved in prostate gland development
  • dorsal/ventral neural tube patterning
  • myotube differentiation
  • regulation of prostatic bud formation
  • limb bud formation
  • intermediate filament organization
  • neuron fate commitment
  • male genitalia development
  • positive regulation of neuroblast proliferation
  • epithelial-mesenchymal signaling involved in prostate gland development
  • negative regulation of T cell proliferation
  • regulation of protein localization to nucleus
  • lung lobe morphogenesis
  • hindbrain development
  • embryonic skeletal system development
  • organ formation
  • branching morphogenesis of an epithelial tube
  • T cell differentiation in thymus
  • formation of anatomical boundary
  • positive regulation of oligodendrocyte differentiation
  • regulation of proteolysis
  • renal system development
  • lung-associated mesenchyme development
  • cell development
  • positive regulation of transcription, DNA-templated
  • pattern specification process
  • camera-type eye development
  • thymus development
  • hindgut morphogenesis
  • odontogenesis of dentin-containing tooth
  • inner ear development
  • right lung development
  • mesenchymal cell proliferation involved in lung development
  • embryonic limb morphogenesis
  • protein localization to nucleus
  • polarity specification of anterior/posterior axis
  • central nervous system development
  • negative regulation of proteasomal ubiquitin-dependent protein catabolic process
  • blood coagulation
  • intein-mediated protein splicing
Components
  • extracellular region
  • nucleus
  • plasma membrane
  • extracellular space
  • membrane raft
  • cell surface
  • cytosol
  • proteinaceous extracellular matrix
  • endoplasmic reticulum lumen
General FunctionZinc ion binding
Specific FunctionIntercellular signal essential for a variety of patterning events during development: signal produced by the notochord that induces ventral cell fate in the neural tube and somites, and the polarizing signal for patterning of the anterior-posterior axis of the developing limb bud. Displays both floor plate- and motor neuron-inducing activity. The threshold concentration of N-product required for motor neuron induction is 5-fold lower than that required for floor plate induction. Activates the transcription of target genes by interacting with its receptor PTCH1 to prevent normal inhibition by PTCH1 on the constitutive signaling activity of SMO (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ15465
UniProtKB Entry NameSHH_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0013930|Sonic hedgehog protein (SHH)
ATGCTGCTGCTGGCGAGATGTCTGCTGCTAGTCCTCGTCTCCTCGCTGCTGGTATGCTCG
GGACTGGCGTGCGGACCGGGCAGGGGGTTCGGGAAGAGGAGGCACCCCAAAAAGCTGACC
CCTTTAGCCTACAAGCAGTTTATCCCCAATGTGGCCGAGAAGACCCTAGGCGCCAGCGGA
AGGTATGAAGGGAAGATCTCCAGAAACTCCGAGCGATTTAAGGAACTCACCCCCAATTAC
AACCCCGACATCATATTTAAGGATGAAGAAAACACCGGAGCGGACAGGCTGATGACTCAG
AGGTGTAAGGACAAGTTGAACGCTTTGGCCATCTCGGTGATGAACCAGTGGCCAGGAGTG
AAACTGCGGGTGACCGAGGGCTGGGACGAAGATGGCCACCACTCAGAGGAGTCTCTGCAC
TACGAGGGCCGCGCAGTGGACATCACCACGTCTGACCGCGACCGCAGCAAGTACGGCATG
CTGGCCCGCCTGGCGGTGGAGGCCGGCTTCGACTGGGTGTACTACGAGTCCAAGGCACAT
ATCCACTGCTCGGTGAAAGCAGAGAACTCGGTGGCGGCCAAATCGGGAGGCTGCTTCCCG
GGCTCGGCCACGGTGCACCTGGAGCAGGGCGGCACCAAGCTGGTGAAGGACCTGAGCCCC
GGGGACCGCGTGCTGGCGGCGGACGACCAGGGCCGGCTGCTCTACAGCGACTTCCTCACT
TTCCTGGACCGCGACGACGGCGCCAAGAAGGTCTTCTACGTGATCGAGACGCGGGAGCCG
CGCGAGCGCCTGCTGCTCACCGCCGCGCACCTGCTCTTTGTGGCGCCGCACAACGACTCG
GCCACCGGGGAGCCCGAGGCGTCCTCGGGCTCGGGGCCGCCTTCCGGGGGCGCACTGGGG
CCTCGGGCGCTGTTCGCCAGCCGCGTGCGCCCGGGCCAGCGCGTGTACGTGGTGGCCGAG
CGTGACGGGGACCGCCGGCTCCTGCCCGCCGCTGTGCACAGCGTGACCCTAAGCGAGGAG
GCCGCGGGCGCCTACGCGCCGCTCACGGCCCAGGGCACCATTCTCATCAACCGGGTGCTG
GCCTCGTGCTACGCGGTCATCGAGGAGCACAGCTGGGCGCACCGGGCCTTCGCGCCCTTC
CGCCTGGCGCACGCGCTCCTGGCTGCACTGGCGCCCGCGCGCACGGACCGCGGCGGGGAC
AGCGGCGGCGGGGACCGCGGGGGCGGCGGCGGCAGAGTAGCCCTAACCGCTCCAGGTGCT
GCCGACGCTCCGGGTGCGGGGGCCACCGCGGGCATCCACTGGTACTCGCAGCTGCTCTAC
CAAATAGGCACCTGGCTCCTGGACAGCGAGGCCCTGCACCCGCTGGGCATGGCGGTCAAG
TCCAGCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:10848
Chromosome Location7
LocusNot Available
References
  1. Marigo V, Roberts DJ, Lee SM, Tsukurov O, Levi T, Gastier JM, Epstein DJ, Gilbert DJ, Copeland NG, Seidman CE, et al.: Cloning, expression, and chromosomal location of SHH and IHH: two human homologues of the Drosophila segment polarity gene hedgehog. Genomics. 1995 Jul 1;28(1):44-51. 7590746
  2. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. 12853948
  3. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. 12690205
  4. Pepinsky RB, Zeng C, Wen D, Rayhorn P, Baker DP, Williams KP, Bixler SA, Ambrose CM, Garber EA, Miatkowski K, Taylor FR, Wang EA, Galdes A: Identification of a palmitic acid-modified form of human Sonic hedgehog. J Biol Chem. 1998 May 29;273(22):14037-45. 9593755
  5. Chang DT, Lopez A, von Kessler DP, Chiang C, Simandl BK, Zhao R, Seldin MF, Fallon JF, Beachy PA: Products, genetic linkage and limb patterning activity of a murine hedgehog gene. Development. 1994 Nov;120(11):3339-53. 7720571
  6. Lettice LA, Heaney SJ, Purdie LA, Li L, de Beer P, Oostra BA, Goode D, Elgar G, Hill RE, de Graaff E: A long-range Shh enhancer regulates expression in the developing limb and fin and is associated with preaxial polydactyly. Hum Mol Genet. 2003 Jul 15;12(14):1725-35. 12837695
  7. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. 16335952
  8. Sun M, Ma F, Zeng X, Liu Q, Zhao XL, Wu FX, Wu GP, Zhang ZF, Gu B, Zhao YF, Tian SH, Lin B, Kong XY, Zhang XL, Yang W, Lo WH, Zhang X: Triphalangeal thumb-polysyndactyly syndrome and syndactyly type IV are caused by genomic duplications involving the long range, limb-specific SHH enhancer. J Med Genet. 2008 Sep;45(9):589-95. doi: 10.1136/jmg.2008.057646. Epub 2008 Apr 16. 18417549
  9. Wieczorek D, Pawlik B, Li Y, Akarsu NA, Caliebe A, May KJ, Schweiger B, Vargas FR, Balci S, Gillessen-Kaesbach G, Wollnik B: A specific mutation in the distant sonic hedgehog (SHH) cis-regulator (ZRS) causes Werner mesomelic syndrome (WMS) while complete ZRS duplications underlie Haas type polysyndactyly and preaxial polydactyly (PPD) with or without triphalangeal thumb. Hum Mutat. 2010 Jan;31(1):81-9. doi: 10.1002/humu.21142. 19847792
  10. Lohan S, Spielmann M, Doelken SC, Flottmann R, Muhammad F, Baig SM, Wajid M, Hulsemann W, Habenicht R, Kjaer KW, Patil SJ, Girisha KM, Abarca-Barriga HH, Mundlos S, Klopocki E: Microduplications encompassing the Sonic hedgehog limb enhancer ZRS are associated with Haas-type polysyndactyly and Laurin-Sandrow syndrome. Clin Genet. 2014 Oct;86(4):318-25. doi: 10.1111/cge.12352. Epub 2014 Feb 17. 24456159
  11. Norbnop P, Srichomthong C, Suphapeetiporn K, Shotelersuk V: ZRS 406A>G mutation in patients with tibial hypoplasia, polydactyly and triphalangeal first fingers. J Hum Genet. 2014 Aug;59(8):467-70. doi: 10.1038/jhg.2014.50. Epub 2014 Jun 26. 24965254
  12. Pepinsky RB, Rayhorn P, Day ES, Dergay A, Williams KP, Galdes A, Taylor FR, Boriack-Sjodin PA, Garber EA: Mapping sonic hedgehog-receptor interactions by steric interference. J Biol Chem. 2000 Apr 14;275(15):10995-1001. 10753901
  13. Bosanac I, Maun HR, Scales SJ, Wen X, Lingel A, Bazan JF, de Sauvage FJ, Hymowitz SG, Lazarus RA: The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling. Nat Struct Mol Biol. 2009 Jul;16(7):691-7. doi: 10.1038/nsmb.1632. Epub 2009 Jun 28. 19561609
  14. Maun HR, Wen X, Lingel A, de Sauvage FJ, Lazarus RA, Scales SJ, Hymowitz SG: Hedgehog pathway antagonist 5E1 binds hedgehog at the pseudo-active site. J Biol Chem. 2010 Aug 20;285(34):26570-80. doi: 10.1074/jbc.M110.112284. Epub 2010 May 26. 20504762
  15. Roessler E, Belloni E, Gaudenz K, Jay P, Berta P, Scherer SW, Tsui LC, Muenke M: Mutations in the human Sonic Hedgehog gene cause holoprosencephaly. Nat Genet. 1996 Nov;14(3):357-60. 8896572
  16. Roessler E, Belloni E, Gaudenz K, Vargas F, Scherer SW, Tsui LC, Muenke M: Mutations in the C-terminal domain of Sonic Hedgehog cause holoprosencephaly. Hum Mol Genet. 1997 Oct;6(11):1847-53. 9302262
  17. Odent S, Atti-Bitach T, Blayau M, Mathieu M, Aug J, Delezo de AL, Gall JY, Le Marec B, Munnich A, David V, Vekemans M: Expression of the Sonic hedgehog (SHH ) gene during early human development and phenotypic expression of new mutations causing holoprosencephaly. Hum Mol Genet. 1999 Sep;8(9):1683-9. 10441331
  18. Nanni L, Ming JE, Bocian M, Steinhaus K, Bianchi DW, Die-Smulders C, Giannotti A, Imaizumi K, Jones KL, Campo MD, Martin RA, Meinecke P, Pierpont ME, Robin NH, Young ID, Roessler E, Muenke M: The mutational spectrum of the sonic hedgehog gene in holoprosencephaly: SHH mutations cause a significant proportion of autosomal dominant holoprosencephaly. Hum Mol Genet. 1999 Dec;8(13):2479-88. 10556296
  19. Nanni L, Ming JE, Du Y, Hall RK, Aldred M, Bankier A, Muenke M: SHH mutation is associated with solitary median maxillary central incisor: a study of 13 patients and review of the literature. Am J Med Genet. 2001 Jul 22;102(1):1-10. 11471164
  20. Orioli IM, Castilla EE, Ming JE, Nazer J, Burle de Aguiar MJ, Llerena JC, Muenke M: Identification of novel mutations in SHH and ZIC2 in a South American (ECLAMC) population with holoprosencephaly. Hum Genet. 2001 Jul;109(1):1-6. 11479728
  21. Schimmenti LA, de la Cruz J, Lewis RA, Karkera JD, Manligas GS, Roessler E, Muenke M: Novel mutation in sonic hedgehog in non-syndromic colobomatous microphthalmia. Am J Med Genet A. 2003 Jan 30;116A(3):215-21. 12503095
  22. Garavelli L, Zanacca C, Caselli G, Banchini G, Dubourg C, David V, Odent S, Gurrieri F, Neri G: Solitary median maxillary central incisor syndrome: clinical case with a novel mutation of sonic hedgehog. Am J Med Genet A. 2004 May 15;127A(1):93-5. 15103725
  23. Hehr U, Gross C, Diebold U, Wahl D, Beudt U, Heidemann P, Hehr A, Mueller D: Wide phenotypic variability in families with holoprosencephaly and a sonic hedgehog mutation. Eur J Pediatr. 2004 Jul;163(7):347-52. Epub 2004 Apr 24. 15107988
  24. Dubourg C, Lazaro L, Pasquier L, Bendavid C, Blayau M, Le Duff F, Durou MR, Odent S, David V: Molecular screening of SHH, ZIC2, SIX3, and TGIF genes in patients with features of holoprosencephaly spectrum: Mutation review and genotype-phenotype correlations. Hum Mutat. 2004 Jul;24(1):43-51. 15221788
  25. El-Jaick KB, Brunoni D, Castilla EE, Moreira MA, Orioli IM: SHH Ile111Asp in alobar holoprosencephaly in a proposita, whose mother had only a solitary median maxillary incisor. Am J Med Genet A. 2005 Aug 1;136A(4):345. 15942952
  26. Ribeiro LA, Richieri-Costa A: Single median maxillary central incisor, hypophyseal tumor, and SHH mutation. Am J Med Genet A. 2005 Aug 1;136A(4):346-7. 15942953
  27. Maity T, Fuse N, Beachy PA: Molecular mechanisms of Sonic hedgehog mutant effects in holoprosencephaly. Proc Natl Acad Sci U S A. 2005 Nov 22;102(47):17026-31. Epub 2005 Nov 10. 16282375
  28. Richieri-Costa A, Ribeiro LA: Holoprosencephaly-like phenotype: clinical and genetic perspectives. Am J Med Genet A. 2006 Dec 1;140(23):2587-93. 17001669
  29. Roessler E, El-Jaick KB, Dubourg C, Velez JI, Solomon BD, Pineda-Alvarez DE, Lacbawan F, Zhou N, Ouspenskaia M, Paulussen A, Smeets HJ, Hehr U, Bendavid C, Bale S, Odent S, David V, Muenke M: The mutational spectrum of holoprosencephaly-associated changes within the SHH gene in humans predicts loss-of-function through either key structural alterations of the ligand or its altered synthesis. Hum Mutat. 2009 Oct;30(10):E921-35. doi: 10.1002/humu.21090. 19603532