NameRho-related GTP-binding protein RhoG
Synonyms
  • ARHG
Gene NameRHOG
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013611|Rho-related GTP-binding protein RhoG
MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAG
QEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLR
AQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPT
PIKRGRSCILL
Number of residues191
Molecular Weight21308.34
Theoretical pINot Available
GO Classification
Functions
  • GTP binding
  • GTPase activity
Processes
  • axon guidance
  • positive regulation of transcription, DNA-templated
  • positive regulation of cell proliferation
  • cell chemotaxis
  • Rho protein signal transduction
  • activation of GTPase activity
  • positive regulation of establishment of protein localization to plasma membrane
  • regulation of small GTPase mediated signal transduction
  • blood coagulation
  • Rac protein signal transduction
  • regulation of ruffle assembly
  • small GTPase mediated signal transduction
  • platelet activation
  • actin cytoskeleton organization
Components
  • focal adhesion
  • plasma membrane
  • endoplasmic reticulum membrane
  • cytosol
  • extracellular exosome
General FunctionGtpase activity
Specific FunctionRequired for the formation of membrane ruffles during macropinocytosis. Plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, activated by SopB and ARHGEF26/SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP84095
UniProtKB Entry NameRHOG_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0013612|Rho-related GTP-binding protein RhoG (RHOG)
ATGCAGAGCATCAAGTGCGTGGTGGTGGGTGATGGGGCTGTGGGCAAGACGTGCCTGCTC
ATCTGCTACACAACTAACGCTTTCCCCAAAGAGTACATCCCCACCGTGTTCGACAATTAC
AGCGCGCAGAGCGCAGTTGACGGGCGCACAGTGAACCTGAACCTGTGGGACACTGCGGGC
CAGGAGGAGTATGACCGCCTCCGTACACTCTCCTACCCTCAGACCAACGTTTTCGTCATC
TGTTTCTCCATTGCCAGTCCGCCGTCCTATGAGAACGTGCGGCACAAGTGGCATCCAGAG
GTGTGCCACCACTGCCCTGATGTGCCCATCCTGCTGGTGGGCACCAAGAAGGACCTGAGA
GCCCAGCCTGACACCCTACGGCGCCTCAAGGAGCAGGGCCAGGCGCCCATCACACCGCAG
CAGGGCCAGGCACTGGCCAAGCAGATCCACGCTGTGCGCTACCTCGAATGCTCAGCCCTG
CAACAGGATGGTGTCAAGGAAGTGTTCGCCGAGGCTGTCCGGGCTGTGCTCAACCCCACG
CCGATCAAGCGTGGGCGGTCCTGCATCCTCTTGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:672
Chromosome Location11
LocusNot Available
References
  1. Vincent S, Jeanteur P, Fort P: Growth-regulated expression of rhoG, a new member of the ras homolog gene family. Mol Cell Biol. 1992 Jul;12(7):3138-48. 1620121
  2. Miki T, Smith CL, Long JE, Eva A, Fleming TP: Oncogene ect2 is related to regulators of small GTP-binding proteins. Nature. 1993 Apr 1;362(6419):462-5. 8464478
  3. Ellerbroek SM, Wennerberg K, Arthur WT, Dunty JM, Bowman DR, DeMali KA, Der C, Burridge K: SGEF, a RhoG guanine nucleotide exchange factor that stimulates macropinocytosis. Mol Biol Cell. 2004 Jul;15(7):3309-19. Epub 2004 May 7. 15133129
  4. Patel JC, Galan JE: Differential activation and function of Rho GTPases during Salmonella-host cell interactions. J Cell Biol. 2006 Nov 6;175(3):453-63. Epub 2006 Oct 30. 17074883
  5. van Buul JD, Allingham MJ, Samson T, Meller J, Boulter E, Garcia-Mata R, Burridge K: RhoG regulates endothelial apical cup assembly downstream from ICAM1 engagement and is involved in leukocyte trans-endothelial migration. J Cell Biol. 2007 Sep 24;178(7):1279-93. Epub 2007 Sep 17. 17875742
  6. Hiramoto-Yamaki N, Takeuchi S, Ueda S, Harada K, Fujimoto S, Negishi M, Katoh H: Ephexin4 and EphA2 mediate cell migration through a RhoG-dependent mechanism. J Cell Biol. 2010 Aug 9;190(3):461-77. doi: 10.1083/jcb.201005141. Epub 2010 Aug 2. 20679435
  7. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  8. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712