NameAquaporin-1
Synonyms
  • AQP-1
  • Aquaporin-CHIP
  • CHIP28
  • Urine water channel
  • Water channel protein for red blood cells and kidney proximal tubule
Gene NameAQP1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001754|Aquaporin-1
MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSI
ATLAQSVGHISGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLT
GNSLGRNDLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGH
LLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTD
RVKVWTSGQVEEYDLDADDINSRVEMKPK
Number of residues269
Molecular Weight28525.68
Theoretical pI7.5
GO Classification
Functions
  • potassium channel activity
  • potassium ion transmembrane transporter activity
  • glycerol transmembrane transporter activity
  • water transmembrane transporter activity
  • transmembrane transporter activity
  • ammonium transmembrane transporter activity
  • carbon dioxide transmembrane transporter activity
  • intracellular cGMP activated cation channel activity
  • glycerol channel activity
  • nitric oxide transmembrane transporter activity
  • water channel activity
Processes
  • cation transmembrane transport
  • glycerol transport
  • cellular response to inorganic substance
  • pancreatic juice secretion
  • lateral ventricle development
  • cellular response to stress
  • potassium ion transport
  • response to drug
  • cellular response to nitric oxide
  • potassium ion transmembrane transport
  • cellular response to copper ion
  • establishment or maintenance of actin cytoskeleton polarity
  • cGMP biosynthetic process
  • cerebrospinal fluid secretion
  • maintenance of symbiont-containing vacuole by host
  • nitric oxide transport
  • cell volume homeostasis
  • cellular response to UV
  • transepithelial water transport
  • small molecule metabolic process
  • ammonium transmembrane transport
  • multicellular organismal water homeostasis
  • carbon dioxide transport
  • odontogenesis
  • cellular response to mercury ion
  • renal water transport
  • cellular response to hypoxia
  • positive regulation of angiogenesis
  • transmembrane transport
  • cellular homeostasis
  • ammonium transport
  • cellular response to mechanical stimulus
  • positive regulation of saliva secretion
  • bicarbonate transport
  • cellular response to retinoic acid
  • positive regulation of fibroblast proliferation
  • cellular response to dexamethasone stimulus
  • negative regulation of apoptotic process
  • cellular response to salt stress
  • cellular response to hydrogen peroxide
  • negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
  • renal water homeostasis
  • carbon dioxide transmembrane transport
  • water transport
  • cellular response to cAMP
  • cellular water homeostasis
  • cellular hyperosmotic response
Components
  • brush border membrane
  • nucleus
  • basal plasma membrane
  • plasma membrane
  • extracellular exosome
  • sarcolemma
  • nuclear membrane
  • brush border
  • integral component of plasma membrane
  • apical part of cell
  • symbiont-containing vacuole
  • basolateral plasma membrane
  • apical plasma membrane
  • cytoplasm
General FunctionWater transmembrane transporter activity
Specific FunctionForms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
Pfam Domain Function
Transmembrane Regions8-36 49-66 95-115 137-155 167-183 208-228
GenBank Protein ID180501
UniProtKB IDP29972
UniProtKB Entry NameAQP1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0021277|Aquaporin-1 (AQP1)
ATGCCTGGGGCTCGCCCCTTGCCTCTGGTCTTGGTACCCCAGAATACCCTGGCCTGGATG
CAGCTGGATGCAAAGGCCCCAGCTCACCCCAGGCCTCTCCAGCTTCTAGGCAGAGTGGGG
CCTGGGTCTAGGCAGCTGGCTGATGGTGTGAACTCGGGCCAGGGCCTGGGCATCGAGATC
ATCGGGACCCTCCAGCTGGTGCTATGCGTGCTGGCTACTACCGACCGGAGGCGCCGTGAC
CTTGGTGGCTCAGCCCCCCTTGCCATCGGCCTCTCTGTAGCCCTTGGACACCTCCTGGCT
ATTGACTACACTGGCTGTGGGATTAACCCTGCTCGGTCCTTTGGCTCCGCGGTGATCACA
CACAACTTCAGCAACCACTGGATTTTCTGGGTGGGGCCATTCATCGGGGGAGCCCTGGCT
GTACTCATCTACGACTTCATCCTGGCCCCACGCAGCAGTGACCTCACAGACCGCGTGAAG
GTGTGGACCAGCGGCCAGGTGGAGGAGTATGACCTGGATGCCGACGACATCAACTCCAGG
GTGGAGATGAAGCCCAAATAG
GenBank Gene IDM77829
GeneCard IDNot Available
GenAtlas IDAQP1
HGNC IDHGNC:633
Chromosome Location7
Locus7p14
References
  1. Preston GM, Agre P: Isolation of the cDNA for erythrocyte integral membrane protein of 28 kilodaltons: member of an ancient channel family. Proc Natl Acad Sci U S A. 1991 Dec 15;88(24):11110-4. 1722319
  2. Moon C, Preston GM, Griffin CA, Jabs EW, Agre P: The human aquaporin-CHIP gene. Structure, organization, and chromosomal localization. J Biol Chem. 1993 Jul 25;268(21):15772-8. 8340403
  3. Ruiz A, Bok D: Characterization of the 3' UTR sequence encoded by the AQP-1 gene in human retinal pigment epithelium. Biochim Biophys Acta. 1996 Jul 25;1282(2):174-8. 8703970
  4. Li X, Yu H, Koide SS: The water channel gene in human uterus. Biochem Mol Biol Int. 1994 Feb;32(2):371-7. 7517253
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  6. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. 19054851
  7. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. 12853948
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  9. Smith BL, Agre P: Erythrocyte Mr 28,000 transmembrane protein exists as a multisubunit oligomer similar to channel proteins. J Biol Chem. 1991 Apr 5;266(10):6407-15. 2007592
  10. Preston GM, Carroll TP, Guggino WB, Agre P: Appearance of water channels in Xenopus oocytes expressing red cell CHIP28 protein. Science. 1992 Apr 17;256(5055):385-7. 1373524
  11. Preston GM, Jung JS, Guggino WB, Agre P: The mercury-sensitive residue at cysteine 189 in the CHIP28 water channel. J Biol Chem. 1993 Jan 5;268(1):17-20. 7677994
  12. Preston GM, Jung JS, Guggino WB, Agre P: Membrane topology of aquaporin CHIP. Analysis of functional epitope-scanning mutants by vectorial proteolysis. J Biol Chem. 1994 Jan 21;269(3):1668-73. 7507481
  13. Rungaldier S, Oberwagner W, Salzer U, Csaszar E, Prohaska R: Stomatin interacts with GLUT1/SLC2A1, band 3/SLC4A1, and aquaporin-1 in human erythrocyte membrane domains. Biochim Biophys Acta. 2013 Mar;1828(3):956-66. doi: 10.1016/j.bbamem.2012.11.030. Epub 2012 Dec 3. 23219802
  14. Walz T, Smith BL, Agre P, Engel A: The three-dimensional structure of human erythrocyte aquaporin CHIP. EMBO J. 1994 Jul 1;13(13):2985-93. 7518771
  15. Walz T, Hirai T, Murata K, Heymann JB, Mitsuoka K, Fujiyoshi Y, Smith BL, Agre P, Engel A: The three-dimensional structure of aquaporin-1. Nature. 1997 Jun 5;387(6633):624-7. 9177353
  16. Murata K, Mitsuoka K, Hirai T, Walz T, Agre P, Heymann JB, Engel A, Fujiyoshi Y: Structural determinants of water permeation through aquaporin-1. Nature. 2000 Oct 5;407(6804):599-605. 11034202
  17. de Groot BL, Engel A, Grubmuller H: A refined structure of human aquaporin-1. FEBS Lett. 2001 Aug 31;504(3):206-11. 11532455
  18. Ren G, Reddy VS, Cheng A, Melnyk P, Mitra AK: Visualization of a water-selective pore by electron crystallography in vitreous ice. Proc Natl Acad Sci U S A. 2001 Feb 13;98(4):1398-403. Epub 2001 Jan 30. 11171962
  19. Smith BL, Preston GM, Spring FA, Anstee DJ, Agre P: Human red cell aquaporin CHIP. I. Molecular characterization of ABH and Colton blood group antigens. J Clin Invest. 1994 Sep;94(3):1043-9. 7521882
  20. Preston GM, Smith BL, Zeidel ML, Moulds JJ, Agre P: Mutations in aquaporin-1 in phenotypically normal humans without functional CHIP water channels. Science. 1994 Sep 9;265(5178):1585-7. 7521540