NameCyclic AMP-responsive element-binding protein 1
Synonyms
  • CREB-1
Gene NameCREB1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001907|Cyclic AMP-responsive element-binding protein 1
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
Number of residues341
Molecular Weight36687.86
Theoretical pI5.24
GO Classification
Functions
  • RNA polymerase II core promoter proximal region sequence-specific DNA binding
  • RNA polymerase II activating transcription factor binding
  • transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
  • enzyme binding
  • RNA polymerase II distal enhancer sequence-specific DNA binding
  • transcription cofactor activity
  • transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
  • transcription factor activity, sequence-specific DNA binding
  • transcriptional activator activity, RNA polymerase II transcription factor binding
  • cAMP response element binding
Processes
  • toll-like receptor signaling pathway
  • viral process
  • lung saccule development
  • positive regulation of transcription, DNA-templated
  • toll-like receptor TLR1
  • regulation of circadian rhythm
  • secretory granule organization
  • fibroblast growth factor receptor signaling pathway
  • toll-like receptor TLR6
  • response to organic substance
  • positive regulation of RNA polymerase II transcriptional preinitiation complex assembly
  • neurotrophin TRK receptor signaling pathway
  • TRIF-dependent toll-like receptor signaling pathway
  • signal transduction
  • response to glucagon
  • regulation of cell size
  • positive regulation of transcription from RNA polymerase II promoter
  • protein phosphorylation
  • circadian rhythm
  • response to drug
  • positive regulation of transforming growth factor beta3 production
  • positive regulation of fat cell differentiation
  • protein stabilization
  • synaptic transmission
  • positive regulation of osteoclast differentiation
  • activation of phospholipase C activity
  • positive regulation of lipid biosynthetic process
  • MyD88-dependent toll-like receptor signaling pathway
  • phosphatidylinositol-mediated signaling
  • lactation
  • MyD88-independent toll-like receptor signaling pathway
  • memory
  • stress-activated MAPK cascade
  • transforming growth factor beta receptor signaling pathway
  • regulation of apoptotic process
  • toll-like receptor 10 signaling pathway
  • toll-like receptor 2 signaling pathway
  • Type I pneumocyte differentiation
  • cellular response to zinc ion
  • axon guidance
  • toll-like receptor 3 signaling pathway
  • Notch signaling pathway
  • epidermal growth factor receptor signaling pathway
  • toll-like receptor 4 signaling pathway
  • pituitary gland development
  • positive regulation of hormone secretion
  • innate immune response
  • toll-like receptor 5 signaling pathway
  • positive regulation of multicellular organism growth
  • negative regulation of transcription by competitive promoter binding
  • Fc-epsilon receptor signaling pathway
  • toll-like receptor 9 signaling pathway
Components
  • mitochondrion
  • nuclear euchromatin
  • nucleus
  • ATF4-CREB1 transcription factor complex
  • nucleoplasm
General FunctionTranscriptional activator activity, rna polymerase ii transcription factor binding
Specific FunctionPhosphorylation-dependent transcription factor that stimulates transcription upon binding to the DNA cAMP response element (CRE), a sequence present in many viral and cellular promoters. Transcription activation is enhanced by the TORC coactivators which act independently of Ser-133 phosphorylation. Involved in different cellular processes including the synchronization of circadian rhythmicity and the differentiation of adipose cells.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID240429
UniProtKB IDP16220
UniProtKB Entry NameCREB1_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0021836|Cyclic AMP-responsive element-binding protein 1 (CREB1)
ATGACCATGGAATCTGGAGCCGAGAACCAGCAGAGTGGAGATGCAGCTGTAACAGAAGCT
GAAAACCAACAAATGACAGTTCAAGCCCAGCCACAGATTGCCACATTAGCCCAGGTATCT
ATGCCAGCAGCTCATGCAACATCATCTGCTCCCACCGTAACTCTAGTACAGCTGCCCAAT
GGGCAGACAGTTCAAGTCCATGGAGTCATTCAGGCGGCCCAGCCATCAGTTATTCAGTCT
CCACAAGTCCAAACAGTTCAGATTTCAACTATTGCAGAAAGTGAAGATTCACAGGAGTCA
GTGGATAGTGTAACTGATTCCCAAAAGCGAAGGGAAATTCTTTCAAGGAGGCCTTCCTAC
AGGAAAATTTTGAATGACTTATCTTCTGATGCACCAGGAGTGCCAAGGATTGAAGAAGAG
AAGTCTGAAGAGGAGACTTCAGCACCTGCCATCACCACTGTAACGGTGCCAACTCCAATT
TACCAAACTAGCAGTGGACAGTATATTGCCATTACCCAGGGAGGAGCAATACAGCTGGCT
AACAATGGTACCGATGGGGTACAGGGCCTGCAAACATTAACCATGACCAATGCAGCAGCC
ACTCAGCCGGGTACTACCATTCTACAGTATGCACAGACCACTGATGGACAGCAGATCTTA
GTGCCCAGCAACCAAGTTGTTGTTCAAGCTGCCTCTGGAGACGTACAAACATACCAGATT
CGCACAGCACCCACTAGCACTATTGCCCCTGGAGTTGTTATGGCATCCTCCCCAGCACTT
CCTACACAGCCTGCTGAAGAAGCAGCACGAAAGAGAGAGGTCCGTCTAATGAAGAACAGG
GAAGCAGCTCGAGAGTGTCGTAGAAAGAAGAAAGAATATGTGAAATGTTTAGAAAACAGA
GTGGCAGTGCTTGAAAATCAAAACAAGACATTGATTGAGGAGCTAAAAGCACTTAAGGAC
CTTTACTGCCACAAATCAGATTAA
GenBank Gene IDS72459
GeneCard IDNot Available
GenAtlas IDCREB1
HGNC IDHGNC:2345
Chromosome Location2
Locus2q34
References
  1. Berkowitz LA, Gilman MZ: Two distinct forms of active transcription factor CREB (cAMP response element binding protein). Proc Natl Acad Sci U S A. 1990 Jul;87(14):5258-62. 2142528
  2. Yoshimura T, Fujisawa J, Yoshida M: Multiple cDNA clones encoding nuclear proteins that bind to the tax-dependent enhancer of HTLV-1: all contain a leucine zipper structure and basic amino acid domain. EMBO J. 1990 Aug;9(8):2537-42. 2196176
  3. Waeber G, Meyer TE, Hoeffler JP, Habener JF: Diversification of cyclic AMP-responsive enhancer binding proteins-generated by alternative exon splicing. Trans Assoc Am Physicians. 1990;103:28-37. 1966745
  4. Hoeffler JP, Meyer TE, Yun Y, Jameson JL, Habener JF: Cyclic AMP-responsive DNA-binding protein: structure based on a cloned placental cDNA. Science. 1988 Dec 9;242(4884):1430-3. 2974179
  5. Short ML, Manohar CF, Furtado MR, Ghadge GD, Wolinsky SM, Thimmapaya B, Jungmann RA: Nucleotide and derived amino-acid sequences of the CRE-binding proteins from rat C6 glioma and HeLa cells. Nucleic Acids Res. 1991 Aug 11;19(15):4290. 1831258
  6. Huang X, Zhang J, Lu L, Yin L, Xu M, Wang Y, Zhou Z, Sha J: Cloning and expression of a novel CREB mRNA splice variant in human testis. Reproduction. 2004 Dec;128(6):775-82. 15579595
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  8. Meyer TE, Waeber G, Lin J, Beckmann W, Habener JF: The promoter of the gene encoding 3',5'-cyclic adenosine monophosphate (cAMP) response element binding protein contains cAMP response elements: evidence for positive autoregulation of gene transcription. Endocrinology. 1993 Feb;132(2):770-80. 8381074
  9. Maguire HF, Hoeffler JP, Siddiqui A: HBV X protein alters the DNA binding specificity of CREB and ATF-2 by protein-protein interactions. Science. 1991 May 10;252(5007):842-4. 1827531
  10. Zhao LJ, Giam CZ: Human T-cell lymphotropic virus type I (HTLV-I) transcriptional activator, Tax, enhances CREB binding to HTLV-I 21-base-pair repeats by protein-protein interaction. Proc Natl Acad Sci U S A. 1992 Aug 1;89(15):7070-4. 1386673
  11. Matthews RP, Guthrie CR, Wailes LM, Zhao X, Means AR, McKnight GS: Calcium/calmodulin-dependent protein kinase types II and IV differentially regulate CREB-dependent gene expression. Mol Cell Biol. 1994 Sep;14(9):6107-16. 8065343
  12. Lee HJ, Mignacca RC, Sakamoto KM: Transcriptional activation of egr-1 by granulocyte-macrophage colony-stimulating factor but not interleukin 3 requires phosphorylation of cAMP response element-binding protein (CREB) on serine 133. J Biol Chem. 1995 Jul 7;270(27):15979-83. 7608156
  13. Du K, Montminy M: CREB is a regulatory target for the protein kinase Akt/PKB. J Biol Chem. 1998 Dec 4;273(49):32377-9. 9829964
  14. De Cesare D, Jacquot S, Hanauer A, Sassone-Corsi P: Rsk-2 activity is necessary for epidermal growth factor-induced phosphorylation of CREB protein and transcription of c-fos gene. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12202-7. 9770464
  15. Conkright MD, Canettieri G, Screaton R, Guzman E, Miraglia L, Hogenesch JB, Montminy M: TORCs: transducers of regulated CREB activity. Mol Cell. 2003 Aug;12(2):413-23. 14536081
  16. Comerford KM, Leonard MO, Karhausen J, Carey R, Colgan SP, Taylor CT: Small ubiquitin-related modifier-1 modification mediates resolution of CREB-dependent responses to hypoxia. Proc Natl Acad Sci U S A. 2003 Feb 4;100(3):986-91. Epub 2003 Jan 27. 12552083
  17. Iourgenko V, Zhang W, Mickanin C, Daly I, Jiang C, Hexham JM, Orth AP, Miraglia L, Meltzer J, Garza D, Chirn GW, McWhinnie E, Cohen D, Skelton J, Terry R, Yu Y, Bodian D, Buxton FP, Zhu J, Song C, Labow MA: Identification of a family of cAMP response element-binding protein coactivators by genome-scale functional analysis in mammalian cells. Proc Natl Acad Sci U S A. 2003 Oct 14;100(21):12147-52. Epub 2003 Sep 23. 14506290
  18. Screaton RA, Conkright MD, Katoh Y, Best JL, Canettieri G, Jeffries S, Guzman E, Niessen S, Yates JR 3rd, Takemori H, Okamoto M, Montminy M: The CREB coactivator TORC2 functions as a calcium- and cAMP-sensitive coincidence detector. Cell. 2004 Oct 1;119(1):61-74. 15454081
  19. Kang J, Shi Y, Xiang B, Qu B, Su W, Zhu M, Zhang M, Bao G, Wang F, Zhang X, Yang R, Fan F, Chen X, Pei G, Ma L: A nuclear function of beta-arrestin1 in GPCR signaling: regulation of histone acetylation and gene transcription. Cell. 2005 Dec 2;123(5):833-47. 16325578
  20. David S, Kalb RG: Serum/glucocorticoid-inducible kinase can phosphorylate the cyclic AMP response element binding protein, CREB. FEBS Lett. 2005 Feb 28;579(6):1534-8. 15733869
  21. Vercauteren K, Pasko RA, Gleyzer N, Marino VM, Scarpulla RC: PGC-1-related coactivator: immediate early expression and characterization of a CREB/NRF-1 binding domain associated with cytochrome c promoter occupancy and respiratory growth. Mol Cell Biol. 2006 Oct;26(20):7409-19. Epub 2006 Aug 14. 16908542
  22. Antonescu CR, Dal Cin P, Nafa K, Teot LA, Surti U, Fletcher CD, Ladanyi M: EWSR1-CREB1 is the predominant gene fusion in angiomatoid fibrous histiocytoma. Genes Chromosomes Cancer. 2007 Dec;46(12):1051-60. 17724745
  23. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. 17525332
  24. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  25. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  26. Sakamoto K, Huang BW, Iwasaki K, Hailemariam K, Ninomiya-Tsuji J, Tsuji Y: Regulation of genotoxic stress response by homeodomain-interacting protein kinase 2 through phosphorylation of cyclic AMP response element-binding protein at serine 271. Mol Biol Cell. 2010 Aug 15;21(16):2966-74. doi: 10.1091/mbc.E10-01-0015. Epub 2010 Jun 23. 20573984
  27. Dittmer S, Kovacs Z, Yuan SH, Siszler G, Kogl M, Summer H, Geerts A, Golz S, Shioda T, Methner A: TOX3 is a neuronal survival factor that induces transcription depending on the presence of CITED1 or phosphorylated CREB in the transcriptionally active complex. J Cell Sci. 2011 Jan 15;124(Pt 2):252-60. doi: 10.1242/jcs.068759. Epub 2010 Dec 15. 21172805
  28. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  29. Kitazawa S, Kondo T, Mori K, Yokoyama N, Matsuo M, Kitazawa R: A p.D116G mutation in CREB1 leads to novel multiple malformation syndrome resembling CrebA knockout mouse. Hum Mutat. 2012 Apr;33(4):651-4. doi: 10.1002/humu.22027. Epub 2012 Feb 14. 22267179
  30. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569