NameFibroblast growth factor 2
Synonyms
  • Basic fibroblast growth factor
  • bFGF
  • FGF-2
  • FGFB
  • HBGF-2
  • Heparin-binding growth factor 2
Gene NameFGF2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037112|Fibroblast growth factor 2
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Number of residues288
Molecular Weight30769.715
Theoretical pI10.01
GO Classification
Functions
  • ligand-dependent nuclear receptor transcription coactivator activity
  • chemoattractant activity
  • growth factor activity
  • fibroblast growth factor receptor binding
  • cytokine activity
  • heparin binding
Processes
  • positive regulation of endothelial cell chemotaxis to fibroblast growth factor
  • wound healing
  • chemotaxis
  • positive regulation of cell division
  • positive regulation of sprouting angiogenesis
  • nervous system development
  • axon guidance
  • regulation of endothelial cell chemotaxis to fibroblast growth factor
  • positive regulation of cell proliferation
  • epidermal growth factor receptor signaling pathway
  • embryonic morphogenesis
  • positive regulation of MAP kinase activity
  • innate immune response
  • negative regulation of blood vessel endothelial cell migration
  • release of sequestered calcium ion into cytosol
  • phosphatidylinositol-mediated signaling
  • Fc-epsilon receptor signaling pathway
  • negative regulation of cell death
  • positive regulation of ERK1 and ERK2 cascade
  • extracellular matrix organization
  • positive regulation of cardiac muscle cell proliferation
  • positive regulation of phosphatidylinositol 3-kinase activity
  • positive regulation of transcription, DNA-templated
  • positive regulation of phospholipase C activity
  • activation of MAPKK activity
  • fibroblast growth factor receptor signaling pathway
  • positive chemotaxis
  • regulation of angiogenesis
  • insulin receptor signaling pathway
  • hyaluronan catabolic process
  • signal transduction
  • negative regulation of wound healing
  • MAPK cascade
  • branching involved in ureteric bud morphogenesis
  • positive regulation of angiogenesis
  • neurotrophin TRK receptor signaling pathway
  • activation of MAPK activity
  • positive regulation of transcription from RNA polymerase II promoter
  • phosphatidylinositol biosynthetic process
  • positive regulation of endothelial cell proliferation
  • Ras protein signal transduction
  • positive regulation of blood vessel endothelial cell migration
  • organ morphogenesis
  • growth factor dependent regulation of skeletal muscle satellite cell proliferation
  • somatic stem cell population maintenance
  • cell migration involved in sprouting angiogenesis
  • inositol phosphate biosynthetic process
  • positive regulation of cell fate specification
  • vascular endothelial growth factor receptor signaling pathway
  • negative regulation of fibroblast migration
  • small GTPase mediated signal transduction
  • chondroblast differentiation
Components
  • extracellular region
  • nucleus
  • extracellular space
General FunctionLigand-dependent nuclear receptor transcription coactivator activity
Specific FunctionPlays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID31362
UniProtKB IDP09038
UniProtKB Entry NameFGF2_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0021843|Fibroblast growth factor 2 (FGF2)
CTGGTGGGTGTGGGGGGTGGAGATGTAGAAGATGTGACGCCGCGGCCCGGCGGGTGCCAG
ATTAGCGGACGCGGTGCCCGCGGTTGCAACGGGATCCCGGGCGCTGCAGCTTGGGAGGCG
GCTCTCCCCAGGCGGCGTCCGCGGAGACACCCATCCGTGAACCCCAGGTCCCGGGCCGCC
GGCTCGCCGCGCACCAGGGGCCGGCGGACAGAAGAGCGGCCGAGCGGCTCGAGGCTGGGG
GACCGCGGGCGCGGCCGCGCGCTGCCGGGCGGGAGGCTGGGGGGCCGGGGCCGGGGCCGT
GCCCCGGAGCGGGTCGGAGGCCGGGGCCGGGGCCGGGGGACGGCGGCTCCCCGCGCGGCT
CCAGCGGCTCGGGGATCCCGGCCGGGCCCCGCAGGGACCATGGCAGCCGGGAGCATCACC
ACGCTGCCCGCCTTGCCCGAGGATGGCGGCAGCGGCGCCTTCCCGCCCGGCCACTTCAAG
GACCCCAAGCGGCTGTACTGCAAAAACGGGGGCTTCTTCCTGCGCATCCACCCCGACGGC
CGAGTTGACGGGGTCCGGGAGAAGAGCGACCCTCACATCAAGCTACAACTTCAAGCAGAA
GAGAGAGGAGTTGTGTCTATCAAAGGAGTGTGTGCTAACCGTTACCTGGCTATGAAGGAA
GATGGAAGATTACTGGCTTCTAAATGTGTTACGGATGAGTGTTTCTTTTTTGAACGATTG
GAATCTAATAACTACAATACTTACCGGTCAAGGAAATACACCAGTTGGTATGTGGCACTG
AAACGAACTGGGCAGTATAAACTTGGATCCAAAACAGGACCTGGGCAGAAAGCTATACTT
TTTCTTCCAATGTCTGCTAAGAGCTGA
GenBank Gene IDX04431
GeneCard IDNot Available
GenAtlas IDFGF2
HGNC IDHGNC:3676
Chromosome Location4
Locus4q26-q27
References
  1. Abraham JA, Whang JL, Tumolo A, Mergia A, Fiddes JC: Human basic fibroblast growth factor: nucleotide sequence, genomic organization, and expression in mammalian cells. Cold Spring Harb Symp Quant Biol. 1986;51 Pt 1:657-68. 3472745
  2. Abraham JA, Whang JL, Tumolo A, Mergia A, Friedman J, Gospodarowicz D, Fiddes JC: Human basic fibroblast growth factor: nucleotide sequence and genomic organization. EMBO J. 1986 Oct;5(10):2523-8. 3780670
  3. Prats H, Kaghad M, Prats AC, Klagsbrun M, Lelias JM, Liauzun P, Chalon P, Tauber JP, Amalric F, Smith JA, et al.: High molecular mass forms of basic fibroblast growth factor are initiated by alternative CUG codons. Proc Natl Acad Sci U S A. 1989 Mar;86(6):1836-40. 2538817
  4. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. 19054851
  5. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621
  6. Florkiewicz RZ, Shibata F, Barankiewicz T, Baird A, Gonzalez AM, Florkiewicz E, Shah N: Basic fibroblast growth factor gene expression. Ann N Y Acad Sci. 1991;638:109-26. 1785797
  7. Kurokawa T, Sasada R, Iwane M, Igarashi K: Cloning and expression of cDNA encoding human basic fibroblast growth factor. FEBS Lett. 1987 Mar 9;213(1):189-94. 2435575
  8. Shimoyama Y, Gotoh M, Ino Y, Sakamoto M, Kato K, Hirohashi S: Characterization of high-molecular-mass forms of basic fibroblast growth factor produced by hepatocellular carcinoma cells: possible involvement of basic fibroblast growth factor in hepatocarcinogenesis. Jpn J Cancer Res. 1991 Nov;82(11):1263-70. 1721615
  9. Izbicka E, Dunstan C, Esparza J, Jacobs C, Sabatini M, Mundy GR: Human amniotic tumor that induces new bone formation in vivo produces growth-regulatory activity in vitro for osteoblasts identified as an extended form of basic fibroblast growth factor. Cancer Res. 1996 Feb 1;56(3):633-6. 8564983
  10. Sommer A, Brewer MT, Thompson RC, Moscatelli D, Presta M, Rifkin DB: A form of human basic fibroblast growth factor with an extended amino terminus. Biochem Biophys Res Commun. 1987 Apr 29;144(2):543-50. 3579930
  11. Story MT, Esch F, Shimasaki S, Sasse J, Jacobs SC, Lawson RK: Amino-terminal sequence of a large form of basic fibroblast growth factor isolated from human benign prostatic hyperplastic tissue. Biochem Biophys Res Commun. 1987 Feb 13;142(3):702-9. 2435284
  12. Gimenez-Gallego G, Conn G, Hatcher VB, Thomas KA: Human brain-derived acidic and basic fibroblast growth factors: amino terminal sequences and specific mitogenic activities. Biochem Biophys Res Commun. 1986 Mar 13;135(2):541-8. 3964259
  13. Gautschi P, Frater-Schroder M, Bohlen P: Partial molecular characterization of endothelial cell mitogens from human brain: acidic and basic fibroblast growth factors. FEBS Lett. 1986 Aug 18;204(2):203-7. 3732516
  14. Watson R, Anthony F, Pickett M, Lambden P, Masson GM, Thomas EJ: Reverse transcription with nested polymerase chain reaction shows expression of basic fibroblast growth factor transcripts in human granulosa and cumulus cells from in vitro fertilisation patients. Biochem Biophys Res Commun. 1992 Sep 30;187(3):1227-31. 1417798
  15. Wu DQ, Kan MK, Sato GH, Okamoto T, Sato JD: Characterization and molecular cloning of a putative binding protein for heparin-binding growth factors. J Biol Chem. 1991 Sep 5;266(25):16778-85. 1885605
  16. Ornitz DM, Xu J, Colvin JS, McEwen DG, MacArthur CA, Coulier F, Gao G, Goldfarb M: Receptor specificity of the fibroblast growth factor family. J Biol Chem. 1996 Jun 21;271(25):15292-7. 8663044
  17. Goretzki L, Burg MA, Grako KA, Stallcup WB: High-affinity binding of basic fibroblast growth factor and platelet-derived growth factor-AA to the core protein of the NG2 proteoglycan. J Biol Chem. 1999 Jun 11;274(24):16831-7. 10358027
  18. Tassi E, Al-Attar A, Aigner A, Swift MR, McDonnell K, Karavanov A, Wellstein A: Enhancement of fibroblast growth factor (FGF) activity by an FGF-binding protein. J Biol Chem. 2001 Oct 26;276(43):40247-53. Epub 2001 Aug 16. 11509569
  19. Skjerpen CS, Wesche J, Olsnes S: Identification of ribosome-binding protein p34 as an intracellular protein that binds acidic fibroblast growth factor. J Biol Chem. 2002 Jun 28;277(26):23864-71. Epub 2002 Apr 18. 11964394
  20. Xie B, Tassi E, Swift MR, McDonnell K, Bowden ET, Wang S, Ueda Y, Tomita Y, Riegel AT, Wellstein A: Identification of the fibroblast growth factor (FGF)-interacting domain in a secreted FGF-binding protein by phage display. J Biol Chem. 2006 Jan 13;281(2):1137-44. Epub 2005 Oct 27. 16257968
  21. Zhang W, Chen Y, Swift MR, Tassi E, Stylianou DC, Gibby KA, Riegel AT, Wellstein A: Effect of FGF-binding protein 3 on vascular permeability. J Biol Chem. 2008 Oct 17;283(42):28329-37. doi: 10.1074/jbc.M802144200. Epub 2008 Jul 31. 18669637
  22. Ebert AD, Laussmann M, Wegehingel S, Kaderali L, Erfle H, Reichert J, Lechner J, Beer HD, Pepperkok R, Nickel W: Tec-kinase-mediated phosphorylation of fibroblast growth factor 2 is essential for unconventional secretion. Traffic. 2010 Jun;11(6):813-26. doi: 10.1111/j.1600-0854.2010.01059.x. Epub 2010 Mar 10. 20230531
  23. Eswarakumar VP, Lax I, Schlessinger J: Cellular signaling by fibroblast growth factor receptors. Cytokine Growth Factor Rev. 2005 Apr;16(2):139-49. Epub 2005 Feb 1. 15863030
  24. Turner N, Grose R: Fibroblast growth factor signalling: from development to cancer. Nat Rev Cancer. 2010 Feb;10(2):116-29. doi: 10.1038/nrc2780. 20094046
  25. Zhen Y, Sorensen V, Skjerpen CS, Haugsten EM, Jin Y, Walchli S, Olsnes S, Wiedlocha A: Nuclear import of exogenous FGF1 requires the ER-protein LRRC59 and the importins Kpnalpha1 and Kpnbeta1. Traffic. 2012 May;13(5):650-64. doi: 10.1111/j.1600-0854.2012.01341.x. Epub 2012 Mar 4. 22321063
  26. Ago H, Kitagawa Y, Fujishima A, Matsuura Y, Katsube Y: Crystal structure of basic fibroblast growth factor at 1.6 A resolution. J Biochem. 1991 Sep;110(3):360-3. 1769963
  27. Eriksson AE, Cousens LS, Weaver LH, Matthews BW: Three-dimensional structure of human basic fibroblast growth factor. Proc Natl Acad Sci U S A. 1991 Apr 15;88(8):3441-5. 1707542
  28. Zhang JD, Cousens LS, Barr PJ, Sprang SR: Three-dimensional structure of human basic fibroblast growth factor, a structural homolog of interleukin 1 beta. Proc Natl Acad Sci U S A. 1991 Apr 15;88(8):3446-50. 1849658
  29. Zhu X, Komiya H, Chirino A, Faham S, Fox GM, Arakawa T, Hsu BT, Rees DC: Three-dimensional structures of acidic and basic fibroblast growth factors. Science. 1991 Jan 4;251(4989):90-3. 1702556
  30. Eriksson AE, Cousens LS, Matthews BW: Refinement of the structure of human basic fibroblast growth factor at 1.6 A resolution and analysis of presumed heparin binding sites by selenate substitution. Protein Sci. 1993 Aug;2(8):1274-84. 7691311
  31. Ibrahimi OA, Eliseenkova AV, Plotnikov AN, Yu K, Ornitz DM, Mohammadi M: Structural basis for fibroblast growth factor receptor 2 activation in Apert syndrome. Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7182-7. Epub 2001 Jun 5. 11390973
  32. Moy FJ, Seddon AP, Bohlen P, Powers R: High-resolution solution structure of basic fibroblast growth factor determined by multidimensional heteronuclear magnetic resonance spectroscopy. Biochemistry. 1996 Oct 22;35(42):13552-61. 8885834