NameInterleukin-3
Synonyms
  • Hematopoietic growth factor
  • IL-3
  • Mast cell growth factor
  • MCGF
  • Multipotential colony-stimulating factor
  • P-cell-stimulating factor
Gene NameIL3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010171|Interleukin-3
MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
GEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKD
GDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Number of residues152
Molecular Weight17232.905
Theoretical pI8.78
GO Classification
Functions
  • cytokine activity
  • interleukin-3 receptor binding
Processes
  • vascular endothelial growth factor receptor signaling pathway
  • nervous system development
  • positive regulation of cell proliferation
  • small GTPase mediated signal transduction
  • cytokine-mediated signaling pathway
  • cell-cell signaling
  • embryonic hemopoiesis
  • positive regulation of DNA replication
  • axon guidance
  • positive regulation of mast cell proliferation
  • epidermal growth factor receptor signaling pathway
  • positive regulation of myeloid leukocyte differentiation
  • innate immune response
  • positive regulation of tyrosine phosphorylation of Stat5 protein
  • positive regulation of peptidyl-tyrosine phosphorylation
  • Fc-epsilon receptor signaling pathway
  • activation of MAPKK activity
  • fibroblast growth factor receptor signaling pathway
  • insulin receptor signaling pathway
  • MAPK cascade
  • neurotrophin TRK receptor signaling pathway
  • Ras protein signal transduction
Components
  • extracellular space
  • intracellular
  • extracellular region
General FunctionInterleukin-3 receptor binding
Specific FunctionGranulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID307059
UniProtKB IDP08700
UniProtKB Entry NameIL3_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0010172|Interleukin-3 (IL3)
ATGAGCCGCCTGCCCGTCCTGCTCCTGCTCCAACTCCTGGTCCGCCCCGGACTCCAAGCT
CCCATGACCCAGACAACGCCCTTGAAGACAAGCTGGGTTAACTGCTCTAACATGATCGAT
GAAATTATAACACACTTAAAGCAGCCACCTTTGCCTTTGCTGGACTTCAACAACCTCAAT
GGGGAAGACCAAGACATTCTGATGGAAAATAACCTTCGAAGGCCAAACCTGGAGGCATTC
AACAGGGCTGTCAAGAGTTTACAGAACGCATCAGCAATTGAGAGCATTCTTAAAAATCTC
CTGCCATGTCTGCCCCTGGCCACGGCCGCACCCACGCGACATCCAATCCATATCAAGGAC
GGTGACTGGAATGAATTCCGGAGGAAACTGACGTTCTATCTGAAAACCCTTGAGAATGCG
CAGGCTCAACAGACGACTTTGAGCCTCGCGATCTTTTGA
GenBank Gene IDM14743
GeneCard IDNot Available
GenAtlas IDIL3
HGNC IDHGNC:6011
Chromosome Location5
Locus5q31.1
References
  1. Dorssers L, Burger H, Bot F, Delwel R, Geurts van Kessel AH, Lowenberg B, Wagemaker G: Characterization of a human multilineage-colony-stimulating factor cDNA clone identified by a conserved noncoding sequence in mouse interleukin-3. Gene. 1987;55(1):115-24. 3497843
  2. Otsuka T, Miyajima A, Brown N, Otsu K, Abrams J, Saeland S, Caux C, de Waal Malefijt R, de Vries J, Meyerson P, et al.: Isolation and characterization of an expressible cDNA encoding human IL-3. Induction of IL-3 mRNA in human T cell clones. J Immunol. 1988 Apr 1;140(7):2288-95. 3127463
  3. Yang YC, Ciarletta AB, Temple PA, Chung MP, Kovacic S, Witek-Giannotti JS, Leary AC, Kriz R, Donahue RE, Wong GG, et al.: Human IL-3 (multi-CSF): identification by expression cloning of a novel hematopoietic growth factor related to murine IL-3. Cell. 1986 Oct 10;47(1):3-10. 3489530
  4. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. 15372022
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Urdal DL, Price V, Sassenfeld HM, Cosman D, Gillis S, Park LS: Molecular characterization of colony-stimulating factors and their receptors: human interleukin-3. Ann N Y Acad Sci. 1989;554:167-76. 2544122
  7. Feng Y, Klein BK, McWherter CA: Three-dimensional solution structure and backbone dynamics of a variant of human interleukin-3. J Mol Biol. 1996 Jun 14;259(3):524-41. 8676386