| Name | Fibroblast growth factor 4 |
|---|
| Synonyms | - FGF-4
- HBGF-4
- Heparin secretory-transforming protein 1
- Heparin-binding growth factor 4
- HST
- HST-1
- HSTF-1
- HSTF1
- KS3
- Transforming protein KS3
|
|---|
| Gene Name | FGF4 |
|---|
| Organism | Human |
|---|
| Amino acid sequence | >lcl|BSEQ0000649|Fibroblast growth factor 4
MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPV
AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP
VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIA
LSKNGKTKKGNRVSPTMKVTHFLPRL |
|---|
| Number of residues | 206 |
|---|
| Molecular Weight | 22047.355 |
|---|
| Theoretical pI | 10.19 |
|---|
| GO Classification | Functions - growth factor activity
- heparin binding
Processes - vascular endothelial growth factor receptor signaling pathway
- positive regulation of cell proliferation
- small GTPase mediated signal transduction
- odontogenesis of dentin-containing tooth
- cell-cell signaling
- phosphatidylinositol-mediated signaling
- axon guidance
- positive regulation of ERK1 and ERK2 cascade
- epidermal growth factor receptor signaling pathway
- apoptotic process involved in morphogenesis
- innate immune response
- cartilage condensation
- Fc-epsilon receptor signaling pathway
- chondroblast differentiation
- activation of MAPKK activity
- cranial suture morphogenesis
- fibroblast growth factor receptor signaling pathway
- embryonic hindlimb morphogenesis
- insulin receptor signaling pathway
- mesenchymal cell proliferation
- MAPK cascade
- positive regulation of cell division
- negative regulation of apoptotic process
- regulation of endothelial cell chemotaxis to fibroblast growth factor
- neurotrophin TRK receptor signaling pathway
- stem cell population maintenance
- positive regulation of transcription from RNA polymerase II promoter
- signal transduction
- Ras protein signal transduction
Components - extracellular region
- intracellular
|
|---|
| General Function | Heparin binding |
|---|
| Specific Function | Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis. |
|---|
| Pfam Domain Function | |
|---|
| Transmembrane Regions | Not Available |
|---|
| GenBank Protein ID | 386788 |
|---|
| UniProtKB ID | P08620 |
|---|
| UniProtKB Entry Name | FGF4_HUMAN |
|---|
| Cellular Location | Secreted |
|---|
| Gene sequence | >lcl|BSEQ0018940|Fibroblast growth factor 4 (FGF4)
ATGTCGGGGCCCGGGACGGCCGCGGTAGCGCTGCTCCCGGCGGTCCTGCTGGCCTTGCTG
GCGCCCTGGGCGGGCCGAGGGGGCGCCGCCGCACCCACTGCACCCAACGGCACGCTGGAG
GCCGAGCTGGAGCGCCGCTGGGAGAGCCTGGTGGCGCTCTCGTTGGCGCGCCTGCCGGTG
GCAGCGCAGCCCAAGGAGGCGGCCGTCCAGAGCGGCGCCGGCGACTACCTGCTGGGCATC
AAGCGGCTGCGGCGGCTCTACTGCAACGTGGGCATCGGCTTCCACCTCCAGGCGCTCCCC
GACGGCCGCATCGGCGGCGCGCACGCGGACACCCGCGACAGCCTGCTGGAGCTCTCGCCC
GTGGAGCGGGGCGTGGTGAGCATCTTCGGCGTGGCCAGCCGGTTCTTCGTGGCCATGAGC
AGCAAGGGCAAGCTCTATGGCTCGCCCTTCTTCACCGATGAGTGCACGTTCAAGGAGATT
CTCCTTCCCAACAACTACAACGCCTACGAGTCCTACAAGTACCCCGGCATGTTCATCGCC
CTGAGCAAGAATGGGAAGACCAAGAAGGGGAACCGAGTGTCGCCCACCATGAAGGTCACC
CACTTCCTCCCCAGGCTGTGA |
|---|
| GenBank Gene ID | J02986 |
|---|
| GeneCard ID | Not Available |
|---|
| GenAtlas ID | FGF4 |
|---|
| HGNC ID | HGNC:3682 |
|---|
| Chromosome Location | 11 |
|---|
| Locus | 11q13.3 |
|---|
| References | - Mayshar Y, Rom E, Chumakov I, Kronman A, Yayon A, Benvenisty N: Fibroblast growth factor 4 and its novel splice isoform have opposing effects on the maintenance of human embryonic stem cell self-renewal. Stem Cells. 2008 Mar;26(3):767-74. doi: 10.1634/stemcells.2007-1037. Epub 2008 Jan 10. 18192227
- Yoshida T, Miyagawa K, Odagiri H, Sakamoto H, Little PF, Terada M, Sugimura T: Genomic sequence of hst, a transforming gene encoding a protein homologous to fibroblast growth factors and the int-2-encoded protein. Proc Natl Acad Sci U S A. 1987 Oct;84(20):7305-9. 2959959
- Taira M, Yoshida T, Miyagawa K, Sakamoto H, Terada M, Sugimura T: cDNA sequence of human transforming gene hst and identification of the coding sequence required for transforming activity. Proc Natl Acad Sci U S A. 1987 May;84(9):2980-4. 2953031
- Delli Bovi P, Curatola AM, Kern FG, Greco A, Ittmann M, Basilico C: An oncogene isolated by transfection of Kaposi's sarcoma DNA encodes a growth factor that is a member of the FGF family. Cell. 1987 Aug 28;50(5):729-37. 2957062
- Ornitz DM, Xu J, Colvin JS, McEwen DG, MacArthur CA, Coulier F, Gao G, Goldfarb M: Receptor specificity of the fibroblast growth factor family. J Biol Chem. 1996 Jun 21;271(25):15292-7. 8663044
- Turner N, Grose R: Fibroblast growth factor signalling: from development to cancer. Nat Rev Cancer. 2010 Feb;10(2):116-29. doi: 10.1038/nrc2780. 20094046
- Bellosta P, Iwahori A, Plotnikov AN, Eliseenkova AV, Basilico C, Mohammadi M: Identification of receptor and heparin binding sites in fibroblast growth factor 4 by structure-based mutagenesis. Mol Cell Biol. 2001 Sep;21(17):5946-57. 11486033
|
|---|