NameApolipoprotein D
Synonyms
  • Apo-D
Gene NameAPOD
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013437|Apolipoprotein D
MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGR
CIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWI
LATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVT
DQVNCPKLS
Number of residues189
Molecular Weight21275.37
Theoretical pINot Available
GO Classification
Functions
  • lipid transporter activity
  • cholesterol binding
Processes
  • response to axon injury
  • negative regulation of smooth muscle cell-matrix adhesion
  • aging
  • tissue regeneration
  • response to drug
  • negative regulation of focal adhesion assembly
  • negative regulation of platelet-derived growth factor receptor signaling pathway
  • lipid transport
  • negative regulation of smooth muscle cell proliferation
  • negative regulation of monocyte chemotactic protein-1 production
  • glucose metabolic process
  • response to reactive oxygen species
  • negative regulation of protein import into nucleus
  • lipid metabolic process
  • negative regulation of cytokine production involved in inflammatory response
  • angiogenesis
  • negative regulation of lipoprotein lipid oxidation
  • negative regulation of T cell migration
  • brain development
  • peripheral nervous system axon regeneration
Components
  • neuronal cell body
  • extracellular region
  • endoplasmic reticulum
  • extracellular space
  • extracellular exosome
  • perinuclear region of cytoplasm
  • cytosolic ribosome
  • dendrite
General FunctionLipid transporter activity
Specific FunctionAPOD occurs in the macromolecular complex with lecithin-cholesterol acyltransferase. It is probably involved in the transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP05090
UniProtKB Entry NameAPOD_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0013438|Apolipoprotein D (APOD)
ATGGTGATGCTGCTGCTGCTGCTTTCCGCACTGGCTGGCCTCTTCGGTGCGGCAGAGGGA
CAAGCATTTCATCTTGGGAAGTGCCCCAATCCTCCGGTGCAGGAGAATTTTGACGTGAAT
AAGTATCTCGGAAGATGGTACGAAATTGAGAAGATCCCAACAACCTTTGAGAATGGACGC
TGCATCCAGGCCAACTACTCACTAATGGAAAACGGAAAGATCAAAGTGTTAAACCAGGAG
TTGAGAGCTGATGGAACTGTGAATCAAATCGAAGGTGAAGCCACCCCAGTTAACCTCACA
GAGCCTGCCAAGCTGGAAGTTAAGTTTTCCTGGTTTATGCCATCGGCACCGTACTGGATC
CTGGCCACCGACTATGAGAACTATGCCCTCGTGTATTCCTGTACCTGCATCATCCAACTT
TTTCACGTGGATTTTGCTTGGATCTTGGCAAGAAACCCTAATCTCCCTCCAGAAACAGTG
GACTCTCTAAAAAATATCCTGACTTCTAATAACATTGATGTCAAGAAAATGACGGTCACA
GACCAGGTGAACTGCCCCAAGCTCTCGTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:612
Chromosome Location3
LocusNot Available
References
  1. Drayna D, Fielding C, McLean J, Baer B, Castro G, Chen E, Comstock L, Henzel W, Kohr W, Rhee L, et al.: Cloning and expression of human apolipoprotein D cDNA. J Biol Chem. 1986 Dec 15;261(35):16535-9. 3453108
  2. Drayna DT, McLean JW, Wion KL, Trent JM, Drabkin HA, Lawn RM: Human apolipoprotein D gene: gene sequence, chromosome localization, and homology to the alpha 2u-globulin superfamily. DNA. 1987 Jun;6(3):199-204. 2439269
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Yang CY, Gu ZW, Blanco-Vaca F, Gaskell SJ, Yang M, Massey JB, Gotto AM Jr, Pownall HJ: Structure of human apolipoprotein D: locations of the intermolecular and intramolecular disulfide links. Biochemistry. 1994 Oct 18;33(41):12451-5. 7918467
  6. Holzfeind P, Merschak P, Dieplinger H, Redl B: The human lacrimal gland synthesizes apolipoprotein D mRNA in addition to tear prealbumin mRNA, both species encoding members of the lipocalin superfamily. Exp Eye Res. 1995 Oct;61(4):495-500. 8549691
  7. Balbin M, Freije JM, Fueyo A, Sanchez LM, Lopez-Otin C: Apolipoprotein D is the major protein component in cyst fluid from women with human breast gross cystic disease. Biochem J. 1990 Nov 1;271(3):803-7. 2244881
  8. Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65. 14760718
  9. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. 16335952
  10. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. 19159218
  11. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. 19139490
  12. Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G: Enrichment of glycopeptides for glycan structure and attachment site identification. Nat Methods. 2009 Nov;6(11):809-11. doi: 10.1038/nmeth.1392. Epub 2009 Oct 18. 19838169
  13. Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G: Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD. Mol Cell Proteomics. 2012 Apr;11(4):M111.013649. doi: 10.1074/mcp.M111.013649. Epub 2011 Dec 14. 22171320
  14. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  15. Peitsch MC, Boguski MS: Is apolipoprotein D a mammalian bilin-binding protein? New Biol. 1990 Feb;2(2):197-206. 2083249
  16. Schindler PA, Settineri CA, Collet X, Fielding CJ, Burlingame AL: Site-specific detection and structural characterization of the glycosylation of human plasma proteins lecithin:cholesterol acyltransferase and apolipoprotein D using HPLC/electrospray mass spectrometry and sequential glycosidase digestion. Protein Sci. 1995 Apr;4(4):791-803. 7613477
  17. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. 10391209