NameRetinol-binding protein 4
Synonyms
  • Plasma retinol-binding protein
  • PRBP
  • RBP
Gene NameRBP4
OrganismHuman
Amino acid sequence
>lcl|BSEQ0000625|Retinol-binding protein 4
MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
Number of residues201
Molecular Weight23009.8
Theoretical pI5.85
GO Classification
Functions
  • retinal binding
  • retinol binding
  • retinol transporter activity
Processes
  • embryonic organ morphogenesis
  • embryonic retina morphogenesis in camera-type eye
  • glucose homeostasis
  • eye development
  • embryonic skeletal system development
  • female genitalia morphogenesis
  • lung development
  • heart trabecula formation
  • heart development
  • maintenance of gastrointestinal epithelium
  • phototransduction, visible light
  • positive regulation of immunoglobulin secretion
  • negative regulation of cardiac muscle cell proliferation
  • retinol transport
  • urinary bladder development
  • retinoid metabolic process
  • vagina development
  • response to ethanol
  • retinol metabolic process
  • uterus development
  • gluconeogenesis
  • cardiac muscle tissue development
  • visual perception
  • positive regulation of insulin secretion
  • response to retinoic acid
Components
  • extracellular exosome
  • protein complex
  • extracellular region
  • extracellular space
  • cytosol
General FunctionRetinol transporter activity
Specific FunctionDelivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID35897
UniProtKB IDP02753
UniProtKB Entry NameRET4_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0010244|Retinol-binding protein 4 (RBP4)
ATGAAGTGGGTGTGGGCGCTCTTGCTGTTGGCGGCGCTGGGCAGCGGCCGCGCGGAGCGC
GACTGCCGAGTGAGCAGCTTCCGAGTCAAGGAGAACTTCGACAAGGCTCGCTTCTCTGGG
ACCTGGTACGCCATGGCCAAGAAGGACCCCGAGGGCCTCTTTCTGCAGGACAACATCGTC
GCGGAGTTCTCCGTGGACGAGACCGGCCAGATGAGCGCCACAGCCAAGGGCCGAGTCCGT
CTTTTGAATAACTGGGACGTGTGCGCAGACATGGTGGGCACCTTCACAGACACCGAGGAC
CCTGCCAAGTTCAAGATGAAGTACTGGGGCGTAGCCTCCTTTCTCCAGAAAGGAAATGAT
GACCACTGGATCGTCGACACAGACTACGACACGTATGCCGTGCAGTACTCCTGCCGCCTC
CTGAACCTCGATGGCACCTGTGCTGACAGCTACTCCTTCGTGTTTTCCCGGGACCCCAAC
GGCCTGCCCCCAGAAGCGCAGAAGATTGTAAGGCAGCGGCAGGAGGAGCTGTGCCTGGCC
AGGCAGTACAGGCTGATCGTCCACAACGGTTACTGCGATGGCAGATCAGAAAGAAACCTT
TTGTAG
GenBank Gene IDX00129
GeneCard IDNot Available
GenAtlas IDRBP4
HGNC IDHGNC:9922
Chromosome Location10
Locus10q23-q24
References
  1. Colantuoni V, Romano V, Bensi G, Santoro C, Costanzo F, Raugei G, Cortese R: Cloning and sequencing of a full length cDNA coding for human retinol-binding protein. Nucleic Acids Res. 1983 Nov 25;11(22):7769-76. 6316270
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. 15164054
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. D'Onofrio C, Colantuoni V, Cortese R: Structure and cell-specific expression of a cloned human retinol binding protein gene: the 5'-flanking region contains hepatoma specific transcriptional signals. EMBO J. 1985 Aug;4(8):1981-9. 2998779
  5. Rask L, Anundi H, Fohlman J, Peterson PA: The complete amino acid sequence of human serum retinol-binding protein. Ups J Med Sci. 1987;92(2):115-46. 2444024
  6. Rask L, Anundi H, Bohme J, Eriksson U, Ronne H, Sege K, Peterson PA: Structural and functional studies of vitamin A-binding proteins. Ann N Y Acad Sci. 1981 Feb 27;359:79-90. 6942701
  7. Rask L, Anundi H, Peterson PA: The primary structure of the human retinol-binding protein. FEBS Lett. 1979 Aug 1;104(1):55-8. 573217
  8. Jaconi S, Rose K, Hughes GJ, Saurat JH, Siegenthaler G: Characterization of two post-translationally processed forms of human serum retinol-binding protein: altered ratios in chronic renal failure. J Lipid Res. 1995 Jun;36(6):1247-53. 7666002
  9. Kiernan UA, Tubbs KA, Nedelkov D, Niederkofler EE, Nelson RW: Comparative phenotypic analyses of human plasma and urinary retinol binding protein using mass spectrometric immunoassay. Biochem Biophys Res Commun. 2002 Sep 20;297(2):401-5. 12237133
  10. Kiernan UA, Tubbs KA, Nedelkov D, Niederkofler EE, McConnell E, Nelson RW: Comparative urine protein phenotyping using mass spectrometric immunoassay. J Proteome Res. 2003 Mar-Apr;2(2):191-7. 12716133
  11. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  12. Cukras C, Gaasterland T, Lee P, Gudiseva HV, Chavali VR, Pullakhandam R, Maranhao B, Edsall L, Soares S, Reddy GB, Sieving PA, Ayyagari R: Exome analysis identified a novel mutation in the RBP4 gene in a consanguineous pedigree with retinal dystrophy and developmental abnormalities. PLoS One. 2012;7(11):e50205. doi: 10.1371/journal.pone.0050205. Epub 2012 Nov 26. 23189188
  13. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  14. Chou CM, Nelson C, Tarle SA, Pribila JT, Bardakjian T, Woods S, Schneider A, Glaser T: Biochemical Basis for Dominant Inheritance, Variable Penetrance, and Maternal Effects in RBP4 Congenital Eye Disease. Cell. 2015 Apr 23;161(3):634-46. doi: 10.1016/j.cell.2015.03.006. 25910211
  15. Newcomer ME, Jones TA, Aqvist J, Sundelin J, Eriksson U, Rask L, Peterson PA: The three-dimensional structure of retinol-binding protein. EMBO J. 1984 Jul;3(7):1451-4. 6540172
  16. Cowan SW, Newcomer ME, Jones TA: Crystallographic refinement of human serum retinol binding protein at 2A resolution. Proteins. 1990;8(1):44-61. 2217163
  17. Monaco HL, Zanotti G: Three-dimensional structure and active site of three hydrophobic molecule-binding proteins with significant amino acid sequence similarity. Biopolymers. 1992 Apr;32(4):457-65. 1623143
  18. Naylor HM, Newcomer ME: The structure of human retinol-binding protein (RBP) with its carrier protein transthyretin reveals an interaction with the carboxy terminus of RBP. Biochemistry. 1999 Mar 2;38(9):2647-53. 10052934
  19. Seeliger MW, Biesalski HK, Wissinger B, Gollnick H, Gielen S, Frank J, Beck S, Zrenner E: Phenotype in retinol deficiency due to a hereditary defect in retinol binding protein synthesis. Invest Ophthalmol Vis Sci. 1999 Jan;40(1):3-11. 9888420
  20. Biesalski HK, Frank J, Beck SC, Heinrich F, Illek B, Reifen R, Gollnick H, Seeliger MW, Wissinger B, Zrenner E: Biochemical but not clinical vitamin A deficiency results from mutations in the gene for retinol binding protein. Am J Clin Nutr. 1999 May;69(5):931-6. 10232633