NameIg alpha-1 chain C region
SynonymsNot Available
Gene NameIGHA1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008861|Ig alpha-1 chain C region
ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDAS
GDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSP
SCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLC
GCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEEL
ALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRV
AAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY
Number of residues353
Molecular Weight37654.29
Theoretical pINot Available
GO Classification
Functions
  • antigen binding
Processes
  • positive regulation of B cell activation
  • protein-chromophore linkage
  • glomerular filtration
  • Fc-gamma receptor signaling pathway involved in phagocytosis
  • innate immune response
  • positive regulation of respiratory burst
  • Fc-epsilon receptor signaling pathway
  • receptor-mediated endocytosis
  • phagocytosis, engulfment
  • retina homeostasis
  • B cell receptor signaling pathway
  • antibacterial humoral response
  • complement activation, classical pathway
  • phagocytosis, recognition
  • immune response
Components
  • extracellular space
  • extracellular exosome
  • monomeric IgA immunoglobulin complex
  • secretory dimeric IgA immunoglobulin complex
  • secretory IgA immunoglobulin complex
  • external side of plasma membrane
  • blood microparticle
  • extracellular region
General FunctionAntigen binding
Specific FunctionIg alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP01876
UniProtKB Entry NameIGHA1_HUMAN
Cellular LocationNot Available
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:5478
Chromosome LocationNot Available
LocusNot Available
References
  1. Flanagan JG, Lefranc MP, Rabbitts TH: Mechanisms of divergence and convergence of the human immunoglobulin alpha 1 and alpha 2 constant region gene sequences. Cell. 1984 Mar;36(3):681-8. 6421489
  2. Putnam FW, Liu YS, Low TL: Primary structure of a human IgA1 immunoglobulin. IV. Streptococcal IgA1 protease, digestion, Fab and Fc fragments, and the complete amino acid sequence of the alpha 1 heavy chain. J Biol Chem. 1979 Apr 25;254(8):2865-74. 107164
  3. Kratzin H, Altevogt P, Ruban E, Kortt A, Staroscik K, Hilschmann N: [The primary structure of a monoclonal IgA-immunoglobulin (IgA Tro.), II. The amino acid sequence of the H-chain, alpha-type, subgroup III; structure of the complete IgA-molecule (author's transl)]. Hoppe Seylers Z Physiol Chem. 1975 Aug;356(8):1337-42. 809331
  4. Yang C, Kratzin H, Gotz H, Hilschmann N: [Rule of antibody structure. Primary structure of a human monoclonal IgA-immunoglobulin (myeloma protein Tro). VII. Purification and characterization of the disulfide bridges]. Hoppe Seylers Z Physiol Chem. 1979 Dec;360(12):1919-40. 393607
  5. Calero M, Escribano J, Grubb A, Mendez E: Location of a novel type of interpolypeptide chain linkage in the human protein HC-IgA complex (HC-IgA) and identification of a heterogeneous chromophore associated with the complex. J Biol Chem. 1994 Jan 7;269(1):384-9. 7506257
  6. Kerr MA: The structure and function of human IgA. Biochem J. 1990 Oct 15;271(2):285-96. 2241915
  7. Hatzivassiliou G, Miller I, Takizawa J, Palanisamy N, Rao PH, Iida S, Tagawa S, Taniwaki M, Russo J, Neri A, Cattoretti G, Clynes R, Mendelsohn C, Chaganti RS, Dalla-Favera R: IRTA1 and IRTA2, novel immunoglobulin superfamily receptors expressed in B cells and involved in chromosome 1q21 abnormalities in B cell malignancy. Immunity. 2001 Mar;14(3):277-89. 11290337
  8. Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A: A proteomic analysis of human bile. Mol Cell Proteomics. 2004 Jul;3(7):715-28. Epub 2004 Apr 14. 15084671
  9. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. 19139490
  10. Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G: Enrichment of glycopeptides for glycan structure and attachment site identification. Nat Methods. 2009 Nov;6(11):809-11. doi: 10.1038/nmeth.1392. Epub 2009 Oct 18. 19838169
  11. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  12. Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G: Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD. Mol Cell Proteomics. 2012 Apr;11(4):M111.013649. doi: 10.1074/mcp.M111.013649. Epub 2011 Dec 14. 22171320
  13. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569