NameCytochrome b5
Synonyms
  • CYB5
  • MCB5
  • Microsomal cytochrome b5 type A
Gene NameCYB5A
OrganismHuman
Amino acid sequence
>lcl|BSEQ0002333|Cytochrome b5
MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDAT
ENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISA
VAVALMYRLYMAED
Number of residues134
Molecular Weight15329.985
Theoretical pI4.61
GO Classification
Functions
  • heme binding
  • aldo-keto reductase (NADP) activity
  • cytochrome-c oxidase activity
  • metal ion binding
  • enzyme binding
Processes
  • small molecule metabolic process
  • vitamin metabolic process
  • water-soluble vitamin metabolic process
  • L-ascorbic acid metabolic process
  • response to cadmium ion
  • hydrogen ion transmembrane transport
Components
  • mitochondrial outer membrane
  • integral component of membrane
  • extracellular exosome
  • intracellular membrane-bounded organelle
  • cytoplasm
  • membrane
  • endoplasmic reticulum membrane
General FunctionMetal ion binding
Specific FunctionCytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.
Pfam Domain Function
Transmembrane Regions109-131
GenBank Protein ID181227
UniProtKB IDP00167
UniProtKB Entry NameCYB5_HUMAN
Cellular LocationEndoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0010818|Cytochrome b5 (CYB5A)
ATGGCAGAGCAGTCGGACGAGGCCGTGAAGTACTACACCCTAGAGGAGATTCAGAAGCAC
AACCACAGCAAGAGCACCTGGCTGATCCTGCACCACAAGGTGTACGATTTGACCAAATTT
CTGGAAGAGCATCCTGGTGGGGAAGAAGTTTTAAGGGAACAAGCTGGAGGTGACGCTACT
GAGAACTTTGAGGATGTCGGGCACTCTACAGATGCCAGGGAAATGTCCAAAACATTCATC
ATTGGGGAGCTCCATCCAGAAACTCTTATCACTACTATTGATTCTAGTTCCAGTTGGTGG
ACCAACTGGGTGATCCCTGCCATCTCTGCAGTGGCCGTCGCCTTGATGTATCGCCTATAC
ATGGCAGAGGACTGA
GenBank Gene IDM22865
GeneCard IDNot Available
GenAtlas IDCYB5A
HGNC IDHGNC:2570
Chromosome Location18
Locus18q23
References
  1. Yoo M, Steggles AW: The complete nucleotide sequence of human liver cytochrome b5 mRNA. Biochem Biophys Res Commun. 1988 Oct 14;156(1):576-80. 3178851
  2. Giordano SJ, Steggles AW: The human liver and reticulocyte cytochrome b5 mRNAs are products from a single gene. Biochem Biophys Res Commun. 1991 Jul 15;178(1):38-44. 1712589
  3. Li XR, Giordano SJ, Yoo M, Steggles AW: The isolation and characterization of the human cytochrome b5 gene. Biochem Biophys Res Commun. 1995 Apr 26;209(3):894-900. 7733981
  4. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. 16177791
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Abe K, Kimura S, Kizawa R, Anan FK, Sugita Y: Amino acid sequences of cytochrome b5 from human, porcine, and bovine erythrocytes and comparison with liver microsomal cytochrome b5. J Biochem. 1985 Jun;97(6):1659-68. 4030743
  7. Nobrega FG, Ozols J: Amino acid sequences of tryptic peptides of cytochromes b5 from microsomes of human, monkey, porcine, and chicken liver. J Biol Chem. 1971 Mar 25;246(6):1706-17. 4993957
  8. Ozols J: Cytochrome b 5 from a normal human liver. Isolation and the partial amino acid sequence. J Biol Chem. 1972 Apr 10;247(7):2242-5. 5062820
  9. Rashid MA, Hagihara B, Kobayashi M, Tani S, Tsugita A: Structural studies of cytochrome b5. 3. Sequential studies on human liver cytochrome b5. J Biochem. 1973 Nov;74(5):985-1002. 4770377
  10. Ozols J: Structure of cytochrome b5 and its topology in the microsomal membrane. Biochim Biophys Acta. 1989 Jul 27;997(1-2):121-30. 2752049
  11. Giordano SJ, Kaftory A, Steggles AW: A splicing mutation in the cytochrome b5 gene from a patient with congenital methemoglobinemia and pseudohermaphrodism. Hum Genet. 1994 May;93(5):568-70. 8168836
  12. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  13. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  14. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712