NameCytochrome b
Synonyms
  • COB
  • Complex III subunit 3
  • Complex III subunit III
  • CYTB
  • Cytochrome b-c1 complex subunit 3
  • MTCYB
  • Ubiquinol-cytochrome-c reductase complex cytochrome b subunit
Gene NameMT-CYB
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010658|Cytochrome b
MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS
TAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILL
LATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFT
FHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLM
TLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILI
LAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFT
TILILMPTISLIENKMLKWA
Number of residues380
Molecular Weight42717.055
Theoretical pI8.22
GO Classification
Functions
  • metal ion binding
  • ubiquinol-cytochrome-c reductase activity
  • electron carrier activity
Processes
  • response to hypoxia
  • respiratory electron transport chain
  • response to calcium ion
  • response to toxic substance
  • response to ethanol
  • response to cadmium ion
  • response to copper ion
  • hydrogen ion transmembrane transport
  • response to mercury ion
  • response to drug
  • response to heat
  • organ regeneration
  • response to glucagon
  • hyperosmotic salinity response
  • mitochondrial electron transport, ubiquinol to cytochrome c
  • small molecule metabolic process
  • response to cobalamin
  • cellular metabolic process
  • response to hyperoxia
Components
  • mitochondrion
  • mitochondrial inner membrane
  • mitochondrial respiratory chain complex III
General FunctionUbiquinol-cytochrome-c reductase activity
Specific FunctionComponent of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.
Pfam Domain Function
Transmembrane Regions33-53 76-98 115-135 138-158 178-198 230-250 288-308 323-343 349-369
GenBank Protein ID13016
UniProtKB IDP00156
UniProtKB Entry NameCYB_HUMAN
Cellular LocationMitochondrion inner membrane
Gene sequence
>lcl|BSEQ0010659|Cytochrome b (MT-CYB)
ATGACCCCAATACGCAAAACTAACCCCCTAATAAAATTAATTAACCACTCATTCATCGAC
CTCCCCACCCCATCCAACATCTCCGCATGATGAAACTTCGGCTCACTCCTTGGCGCCTGC
CTGATCCTCCAAATCACCACAGGACTATTCCTAGCCATGCACTACTCACCAGACGCCTCA
ACCGCCTTTTCATCAATCGCCCACATCACTCGAGACGTAAATTATGGCTGAATCATCCGC
TACCTTCACGCCAATGGCGCCTCAATATTCTTTATCTGCCTCTTCCTACACATCGGGCGA
GGCCTATATTACGGATCATTTCTCTACTCAGAAACCTGAAACATCGGCATTATCCTCCTG
CTTGCAACTATAGCAACAGCCTTCATAGGCTATGTCCTCCCGTGAGGCCAAATATCATTC
TGAGGGGCCACAGTAATTACAAACTTACTATCCGCCATCCCATACATTGGGACAGACCTA
GTTCAATGAATCTGAGGAGGCTACTCAGTAGACAGTCCCACCCTCACACGATTCTTTACC
TTTCACTTCATCTTGCCCTTCATTATTGCAGCCCTAGCAACACTCCACCTCCTATTCTTG
CACGAAACGGGATCAAACAACCCCCTAGGAATCACCTCCCATTCCGATAAAATCACCTTC
CACCCTTACTACACAATCAAAGACGCCCTCGGCTTACTTCTCTTCCTTCTCTCCTTAATG
ACATTAACACTATTCTCACCAGACCTCCTAGGCGACCCAGACAATTATACCCTAGCCAAC
CCCTTAAACACCCCTCCCCACATCAAGCCCGAATGATATTTCCTATTCGCCTACACAATT
CTCCGATCCGTCCCTAACAAACTAGGAGGCGTCCTTGCCCTATTACTATCCATCCTCATC
CTAGCAATAATCCCCATCCTCCATATATCCAAACAACAAAGCATAATATTTCGCCCACTA
AGCCAATCACTTTATTGACTCCTAGCCGCAGACCTCCTCATTCTAACCTGAATCGGAGGA
CAACCAGTAAGCTACCCTTTTACCATCATTGGACAAGTAGCATCCGTACTATACTTCACA
ACAATCCTAATCCTAATACCAACTATCTCCCTAATTGAAAACAAAATACTCAAATGGGCC
T
GenBank Gene IDV00662
GeneCard IDNot Available
GenAtlas IDMT-CYB
HGNC IDHGNC:7427
Chromosome LocationNot Available
Locus-
References
  1. Anderson S, Bankier AT, Barrell BG, de Bruijn MH, Coulson AR, Drouin J, Eperon IC, Nierlich DP, Roe BA, Sanger F, Schreier PH, Smith AJ, Staden R, Young IG: Sequence and organization of the human mitochondrial genome. Nature. 1981 Apr 9;290(5806):457-65. 7219534
  2. Andrews RM, Kubacka I, Chinnery PF, Lightowlers RN, Turnbull DM, Howell N: Reanalysis and revision of the Cambridge reference sequence for human mitochondrial DNA. Nat Genet. 1999 Oct;23(2):147. 10508508
  3. Marin-Garcia J, Ananthakrishnan R, Gonzalvo A, Goldenthal MJ: Novel mutations in mitochondrial cytochrome b in fatal post partum cardiomyopathy. J Inherit Metab Dis. 1995;18(1):77-8. 7623448
  4. Horai S, Hayasaka K, Kondo R, Tsugane K, Takahata N: Recent African origin of modern humans revealed by complete sequences of hominoid mitochondrial DNAs. Proc Natl Acad Sci U S A. 1995 Jan 17;92(2):532-6. 7530363
  5. Ingman M, Kaessmann H, Paabo S, Gyllensten U: Mitochondrial genome variation and the origin of modern humans. Nature. 2000 Dec 7;408(6813):708-13. 11130070
  6. Maca-Meyer N, Gonzalez AM, Larruga JM, Flores C, Cabrera VM: Major genomic mitochondrial lineages delineate early human expansions. BMC Genet. 2001;2:13. Epub 2001 Aug 13. 11553319
  7. Silva WA Jr, Bonatto SL, Holanda AJ, Ribeiro-Dos-Santos AK, Paixao BM, Goldman GH, Abe-Sandes K, Rodriguez-Delfin L, Barbosa M, Paco-Larson ML, Petzl-Erler ML, Valente V, Santos SE, Zago MA: Mitochondrial genome diversity of Native Americans supports a single early entry of founder populations into America. Am J Hum Genet. 2002 Jul;71(1):187-92. Epub 2002 May 17. 12022039
  8. Spurr NK, Bodmer WF: Serendipitous cloning of a mitochondrial cDNA and its polymorphism. Mol Biol Med. 1984 Aug;2(4):239-49. 6100559
  9. Keightley JA, Anitori R, Burton MD, Quan F, Buist NR, Kennaway NG: Mitochondrial encephalomyopathy and complex III deficiency associated with a stop-codon mutation in the cytochrome b gene. Am J Hum Genet. 2000 Dec;67(6):1400-10. Epub 2000 Oct 20. 11047755
  10. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712
  11. Marzuki S, Noer AS, Lertrit P, Thyagarajan D, Kapsa R, Utthanaphol P, Byrne E: Normal variants of human mitochondrial DNA and translation products: the building of a reference data base. Hum Genet. 1991 Dec;88(2):139-45. 1757091
  12. Brown MD, Voljavec AS, Lott MT, Torroni A, Yang CC, Wallace DC: Mitochondrial DNA complex I and III mutations associated with Leber's hereditary optic neuropathy. Genetics. 1992 Jan;130(1):163-73. 1732158
  13. Dumoulin R, Sagnol I, Ferlin T, Bozon D, Stepien G, Mousson B: A novel gly290asp mitochondrial cytochrome b mutation linked to a complex III deficiency in progressive exercise intolerance. Mol Cell Probes. 1996 Oct;10(5):389-91. 8910895
  14. Andreu AL, Bruno C, Shanske S, Shtilbans A, Hirano M, Krishna S, Hayward L, Systrom DS, Brown RH Jr, DiMauro S: Missense mutation in the mtDNA cytochrome b gene in a patient with myopathy. Neurology. 1998 Nov;51(5):1444-7. 9818877
  15. Polyak K, Li Y, Zhu H, Lengauer C, Willson JK, Markowitz SD, Trush MA, Kinzler KW, Vogelstein B: Somatic mutations of the mitochondrial genome in human colorectal tumours. Nat Genet. 1998 Nov;20(3):291-3. 9806551
  16. Valnot I, Kassis J, Chretien D, de Lonlay P, Parfait B, Munnich A, Kachaner J, Rustin P, Rotig A: A mitochondrial cytochrome b mutation but no mutations of nuclearly encoded subunits in ubiquinol cytochrome c reductase (complex III) deficiency. Hum Genet. 1999 Jun;104(6):460-6. 10453733
  17. Andreu AL, Hanna MG, Reichmann H, Bruno C, Penn AS, Tanji K, Pallotti F, Iwata S, Bonilla E, Lach B, Morgan-Hughes J, DiMauro S: Exercise intolerance due to mutations in the cytochrome b gene of mitochondrial DNA. N Engl J Med. 1999 Sep 30;341(14):1037-44. 10502593
  18. Andreu AL, Checcarelli N, Iwata S, Shanske S, DiMauro S: A missense mutation in the mitochondrial cytochrome b gene in a revisited case with histiocytoid cardiomyopathy. Pediatr Res. 2000 Sep;48(3):311-4. 10960495
  19. Wibrand F, Ravn K, Schwartz M, Rosenberg T, Horn N, Vissing J: Multisystem disorder associated with a missense mutation in the mitochondrial cytochrome b gene. Ann Neurol. 2001 Oct;50(4):540-3. 11601507
  20. Legros F, Chatzoglou E, Frachon P, Ogier De Baulny H, Laforet P, Jardel C, Godinot C, Lombes A: Functional characterization of novel mutations in the human cytochrome b gene. Eur J Hum Genet. 2001 Jul;9(7):510-8. 11464242
  21. Schuelke M, Krude H, Finckh B, Mayatepek E, Janssen A, Schmelz M, Trefz F, Trijbels F, Smeitink J: Septo-optic dysplasia associated with a new mitochondrial cytochrome b mutation. Ann Neurol. 2002 Mar;51(3):388-92. 11891837
  22. Okura T, Koda M, Ando F, Niino N, Tanaka M, Shimokata H: Association of the mitochondrial DNA 15497G/A polymorphism with obesity in a middle-aged and elderly Japanese population. Hum Genet. 2003 Oct;113(5):432-6. Epub 2003 Aug 2. 12905068
  23. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460